Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05550 54 / 3e-11 Hypoxia-responsive family protein (.1) AT5G27760 51 / 4e-10 Hypoxia-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015191 [exp] 109 / 2e-33 AT3G05550 87 / 3e-24 Hypoxia-responsive family protein (.1) Lus10020658 [exp] 78 / 7e-21 AT3G05550 94 / 6e-27 Hypoxia-responsive family protein (.1) Lus10029883 [exp] 73 / 2e-17 AT3G05550 93 / 2e-24 Hypoxia-responsive family protein (.1) Lus10033002 [exp] 42 / 1e-06 AT3G05550 50 / 2e-09 Hypoxia-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G024500 [exp] 51 / 3e-10 AT5G27760 102 / 4e-30 Hypoxia-responsive family protein (.1) Potri.019G056000 [exp] 51 / 4e-10 AT3G05550 58 / 1e-12 Hypoxia-responsive family protein (.1) Potri.013G015400 [exp] 51 / 4e-10 AT3G05550 102 / 5e-30 Hypoxia-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04588 [flax] [poplar] HIG_1_N Hypoxia induced protein conserved region
Representative CDS sequence Show only first row Show all	>Lus10031490 pacid=23155929 polypeptide=Lus10031490 locus=Lus10031490.g ID=Lus10031490.BGIv1.0 annot-version=v1.0 ATGGGTCTCCGAGCACAAGATGAGAACCGTCGCGGGATTGCTGGCTCAATAGCCTACAACTGGTCTCAACCCAACATGAAAACCAGCGTCAAGATCATCC ATGCCAGGATGCACGCACAGGCGTTTACATTGGCTGCTCTGGTCGGAGGTGCGGCTGTCGAATGGTATGAACGTAGCCTCACCGAAAAAAGCAAGTGA
AA sequence Show only first row Show all	>Lus10031490 pacid=23155929 polypeptide=Lus10031490 locus=Lus10031490.g ID=Lus10031490.BGIv1.0 annot-version=v1.0 MGLRAQDENRRGIAGSIAYNWSQPNMKTSVKIIHARMHAQAFTLAALVGGAAVEWYERSLTEKSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05550			Hypoxia-responsive family prot...		Lus10031490 [exp]	0	1
					Lus10000984 [exp]	1.4	1.0000
AT1G20330		FRL1, CVP1, SMT...	FRILL1, COTYLEDON VASCULAR PAT...		Lus10004158 [exp]	2.0	1.0000
					Lus10017835 [exp]	3.0	1.0000
					Lus10040014 [exp]	3.5	1.0000
AT3G23350			ENTH/VHS family protein (.1)		Lus10021173 [exp]	3.9	1.0000
AT1G06770		DRIP1	DREB2A-interacting protein 1 (...		Lus10042532 [exp]	4.2	1.0000
AT5G44400			FAD-binding Berberine family p...		Lus10027162 [exp]	4.6	1.0000
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10005439 [exp]	4.9	1.0000
					Lus10032805 [exp]	5.2	1.0000
					Lus10001186 [exp]	5.7	0.9935

Compare expression of checked genes

Lus10031490 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.