Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27700 89 / 2e-25 Ribosomal protein S21e (.1) AT3G53890 83 / 6e-23 Ribosomal protein S21e (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015173 [exp] 98 / 1e-28 AT5G27700 151 / 1e-49 Ribosomal protein S21e (.1) Lus10020645 [exp] 97 / 2e-28 AT5G27700 151 / 7e-50 Ribosomal protein S21e (.1) Lus10029895 [exp] 97 / 4e-28 AT5G27700 85 / 2e-32 Ribosomal protein S21e (.1) Lus10010971 [exp] 92 / 4e-25 AT5G27700 128 / 7e-39 Ribosomal protein S21e (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G017600 [exp] 94 / 3e-27 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1) Potri.005G026000 [exp] 94 / 3e-27 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01249 [flax] [poplar] Ribosomal_S21e Ribosomal protein S21e
Representative CDS sequence Show only first row Show all	>Lus10031494 pacid=23155935 polypeptide=Lus10031494 locus=Lus10031494.g ID=Lus10031494.BGIv1.0 annot-version=v1.0 ATGCAGAACGAAGAAGGCCAGAACGTGGATCTCTACATCCCGAGGAAATGCTCGGCCACCAACAGGCTGATTACCTCCAAGGATCATGCTTCCGTCCAGA TTAACGTCGGTCATTTGGATGCTAACGGCCGGGGGACTGGGGCCGTTACACTGGCCAGTTCACCACTTTTGCTCTCTGTGGATTCGTCCGTGCTCAGGTA A
AA sequence Show only first row Show all	>Lus10031494 pacid=23155935 polypeptide=Lus10031494 locus=Lus10031494.g ID=Lus10031494.BGIv1.0 annot-version=v1.0 MQNEEGQNVDLYIPRKCSATNRLITSKDHASVQINVGHLDANGRGTGAVTLASSPLLLSVDSSVLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27700			Ribosomal protein S21e (.1)		Lus10031494 [exp]	0	1
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10016453 [exp]	2.2	0.9087
AT2G44860			Ribosomal protein L24e family ...		Lus10009403 [exp]	3.5	0.8835
AT3G06700			Ribosomal L29e protein family ...		Lus10016875 [exp]	7.1	0.9224
AT1G26880			Ribosomal protein L34e superfa...		Lus10030477 [exp]	8.0	0.9145
AT1G26880			Ribosomal protein L34e superfa...		Lus10012829 [exp]	8.5	0.9105
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10040718 [exp]	9.6	0.8383
AT3G06700			Ribosomal L29e protein family ...		Lus10037740 [exp]	15.7	0.9112
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10027194 [exp]	15.9	0.8409
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10026664 [exp]	18.2	0.8973
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10034179 [exp]	21.2	0.8766

Compare expression of checked genes

Lus10031494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.