Plant FIBer expression Database

Lus10031503 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55040 89 / 7e-21 zinc finger (Ran-binding) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015180
[exp]
221 / 6e-68 AT1G55040 614 / 0.0 zinc finger (Ran-binding) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G022300
[exp]
85 / 2e-19 AT1G55040 543 / 1e-179 zinc finger (Ran-binding) family protein (.1)
Potri.005G033000
[exp]
84 / 3e-19 AT1G55040 531 / 5e-177 zinc finger (Ran-binding) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10031503 pacid=23155789 polypeptide=Lus10031503 locus=Lus10031503.g ID=Lus10031503.BGIv1.0 annot-version=v1.0
ATGGCGAGAACCCAACTCCGTCTCCTCCTATGTCGACGCTTAAACCCCTACACCTTCTCCCTTTACCAAAACCCTGAACCCCGCCGTCTCACTTCTCTTA
AACCCTACTCCTCCACTTCCGCCGCCGCCAAATCTCCCGACCCGCCGCCGCCGCTGAAACCCAATTCACTCTCCGCCCGTATGAGCTTCGTATTCGATCA
GATCGACGCCATAGAGCGGGACCGCTCGGAGAAGAACGAAACGCTCCAGAAGATCCGCGCTTGGCGCCAATCCAAACAGAATCAGAATCAGCATCAGCCG
GAAACGACGTCGTCGGGGAGAATCTCTGATGCTAAAGCAGCTGTGATTAGCTCCCAGCGTGAAGAAGAAGAAGATGAGCAGCAGCAGCAGTCTGAAACGA
CGCCGTCGAAGAGTGTTCATGAGCCTGTAGAAGAGTATGGTATGAAGAGTAGTAGTAGTAAGCGGGAAGTTGAGCTGGTGCATCCATGGCCAGAATGGAT
AGAGCTGATGGAGAGGCTGGGTTAG
AA sequence
>Lus10031503 pacid=23155789 polypeptide=Lus10031503 locus=Lus10031503.g ID=Lus10031503.BGIv1.0 annot-version=v1.0
MARTQLRLLLCRRLNPYTFSLYQNPEPRRLTSLKPYSSTSAAAKSPDPPPPLKPNSLSARMSFVFDQIDAIERDRSEKNETLQKIRAWRQSKQNQNQHQP
ETTSSGRISDAKAAVISSQREEEEDEQQQQSETTPSKSVHEPVEEYGMKSSSSKREVELVHPWPEWIELMERLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G55040 zinc finger (Ran-binding) fami... Lus10031503
[exp]
0 1
AT5G64270 splicing factor, putative (.1) Lus10034803
[exp]
13.0 0.8636
AT2G07750 DEA(D/H)-box RNA helicase fami... Lus10034110
[exp]
13.3 0.8470
AT4G30990 ARM repeat superfamily protein... Lus10042447
[exp]
15.3 0.8589
AT5G64270 splicing factor, putative (.1) Lus10033347
[exp]
28.1 0.8533
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10017684
[exp]
28.8 0.8481
AT4G17330 ATG2484-1 G2484-1 protein (.1) Lus10004730
[exp]
29.3 0.8517
AT2G41520 TPR15 tetratricopeptide repeat 15, H... Lus10031042
[exp]
33.4 0.8479
AT1G02060 Tetratricopeptide repeat (TPR)... Lus10017658
[exp]
35.7 0.8500
AT4G01860 Transducin family protein / WD... Lus10009986
[exp]
46.0 0.8359
AT5G04240 JUMONJI ELF6 EARLY FLOWERING 6, Zinc finger... Lus10037989
[exp]
46.2 0.8465

Lus10031503 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.