Lus10031529 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05000 300 / 6e-105 AtPFA-DSP1 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
AT4G03960 278 / 3e-96 AtPFA-DSP4 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT2G32960 275 / 2e-94 AtPFA-DSP2 plant and fungi atypical dual-specificity phosphatase 2, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT3G02800 218 / 2e-72 AtPFA-DSP3 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
AT5G16480 209 / 3e-69 AtPFA-DSP5 plant and fungi atypical dual-specificity phosphatase 5, Phosphotyrosine protein phosphatases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015154 355 / 3e-126 AT1G05000 298 / 3e-103 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10029991 315 / 4e-110 AT1G05000 296 / 1e-102 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10035333 313 / 2e-109 AT1G05000 291 / 2e-100 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G159100 325 / 1e-114 AT1G05000 310 / 3e-108 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.002G224000 318 / 7e-112 AT1G05000 300 / 9e-105 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.011G021100 292 / 1e-101 AT4G03960 288 / 4e-100 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
Potri.004G002800 288 / 4e-100 AT1G05000 286 / 4e-99 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.013G086500 214 / 3e-71 AT3G02800 296 / 2e-103 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF03162 Y_phosphatase2 Tyrosine phosphatase family
Representative CDS sequence
>Lus10031529 pacid=23155981 polypeptide=Lus10031529 locus=Lus10031529.g ID=Lus10031529.BGIv1.0 annot-version=v1.0
ATGTGCAGGACGATTGAGGTCGCCTCCGTGATGATCAACCACCGCCGCAGCGAGGATCGGTTATCGGATTCTTCGCTGCAGCCGCTAAGTGATGAGCTGA
GTTTCATCCCGCCGTTGAACTTCGCCATGGTTGATAATGGCATCTTCCGTTCCGGATTCCCTGACTCCGCTAACTTCTCCTTCCTCGAAACTCTGGGCCT
CCGCTCCATCATATGCTTATGCCCGGAGCCGTATCCCGAGGCGAACGCGGAGTTCCTTAAGGCCAACGGAATCAAGCTTTTCCAGTTCGGAATTGAAGGT
TACAAGGAGCCATTTGTAAACATCCCAGAGGACACAATCCGCGAAGCTCTAGAAGTAGTTCTCGATGTGAAGAATCATCCGGTATTGATCCATTGCAAAC
GGGGCAAGCATCGGACAGGTTGCGTGGTGGGATGCTTGCGGAAACTCCAGAAGTGGTGCTTATCGTCGATATTCGACGAGTACCAGAGGTTTGCAGCAGC
CAAAGCTAGAGTATCGGACCAGAGGTTTATGGAGCTGTTCGATGTTTCGAGCTTGAAGCATGTGTCGATGTCGTTTTCGTGCTCCAAGAGATAA
AA sequence
>Lus10031529 pacid=23155981 polypeptide=Lus10031529 locus=Lus10031529.g ID=Lus10031529.BGIv1.0 annot-version=v1.0
MCRTIEVASVMINHRRSEDRLSDSSLQPLSDELSFIPPLNFAMVDNGIFRSGFPDSANFSFLETLGLRSIICLCPEPYPEANAEFLKANGIKLFQFGIEG
YKEPFVNIPEDTIREALEVVLDVKNHPVLIHCKRGKHRTGCVVGCLRKLQKWCLSSIFDEYQRFAAAKARVSDQRFMELFDVSSLKHVSMSFSCSKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05000 AtPFA-DSP1 plant and fungi atypical dual-... Lus10031529 0 1
AT3G47420 AtG3Pp1, ATPS3 Glycerol-3-phosphate permease ... Lus10031153 2.0 0.9226
AT5G49600 Protein of unknown function, D... Lus10037804 2.2 0.8859
AT5G54740 SESA5 seed storage albumin 5 (.1) Lus10023525 3.0 0.8609
AT1G23110 unknown protein Lus10007928 3.5 0.8829
AT5G20150 ATSPX1 ARABIDOPSIS THALIANA SPX DOMA... Lus10019415 4.2 0.9071
AT5G20150 ATSPX1 ARABIDOPSIS THALIANA SPX DOMA... Lus10043272 5.2 0.9038
AT5G20150 ATSPX1 ARABIDOPSIS THALIANA SPX DOMA... Lus10030095 6.0 0.8931
AT5G54770 THI4, TZ, THI1 THIAZOLE REQUIRING, THIAMINE4,... Lus10018364 9.2 0.8803
AT1G68670 GARP myb-like transcription factor ... Lus10035043 9.5 0.8564
AT5G20410 ATMGD2, MGD2 ARABIDOPSIS THALIANA MONOGALAC... Lus10016359 9.5 0.8490

Lus10031529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.