Lus10031533 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47790 56 / 4e-09 F-box and associated interaction domains-containing protein (.1)
AT1G12870 53 / 5e-08 F-box and associated interaction domains-containing protein (.1)
AT3G10240 51 / 2e-07 F-box and associated interaction domains-containing protein (.1)
AT4G21240 49 / 8e-07 F-box and associated interaction domains-containing protein (.1)
AT1G12855 49 / 2e-06 F-box family protein (.1)
AT1G47765 48 / 3e-06 F-box and associated interaction domains-containing protein (.1)
AT3G21170 47 / 6e-06 F-box and associated interaction domains-containing protein (.1)
AT1G53790 46 / 1e-05 F-box and associated interaction domains-containing protein (.1.2)
AT1G31080 45 / 3e-05 F-box family protein (.1)
AT1G51320 45 / 3e-05 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015147 75 / 2e-17 ND 37 / 7e-04
Lus10001105 75 / 2e-15 AT3G06240 109 / 3e-26 F-box family protein (.1)
Lus10015408 74 / 4e-15 AT3G16210 64 / 6e-11 F-box family protein (.1)
Lus10018969 64 / 4e-12 AT1G32420 47 / 4e-06 F-box and associated interaction domains-containing protein (.1)
Lus10029725 64 / 2e-11 AT3G06240 74 / 3e-14 F-box family protein (.1)
Lus10018008 63 / 2e-11 AT3G16210 82 / 6e-17 F-box family protein (.1)
Lus10009424 61 / 2e-10 AT3G06240 73 / 9e-14 F-box family protein (.1)
Lus10014935 60 / 2e-10 AT3G06240 84 / 2e-17 F-box family protein (.1)
Lus10028961 58 / 1e-09 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G318300 67 / 6e-13 AT3G06240 140 / 7e-38 F-box family protein (.1)
Potri.017G058000 54 / 2e-08 AT3G06240 138 / 5e-37 F-box family protein (.1)
Potri.008G006900 53 / 4e-08 AT4G12560 95 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.006G011400 51 / 2e-07 AT4G12560 142 / 2e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.010G207401 48 / 5e-07 AT3G07870 48 / 4e-07 F-box and associated interaction domains-containing protein (.1)
Potri.018G007900 49 / 7e-07 AT2G04920 63 / 1e-10 F-box and associated interaction domains-containing protein (.1)
Potri.010G207500 49 / 7e-07 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.001G318400 49 / 8e-07 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.012G014700 49 / 2e-06 AT1G12170 66 / 1e-11 F-box family protein (.1)
Potri.005G043500 45 / 1e-05 AT5G07610 135 / 7e-36 F-box family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00187 Chitin_bind_1 Chitin recognition protein
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10031533 pacid=23155777 polypeptide=Lus10031533 locus=Lus10031533.g ID=Lus10031533.BGIv1.0 annot-version=v1.0
ATGGGAACGAAGATGAAGAAGAAGCTGGGGATCCTGGTTGCAGTACTGGTACTGTTACTGGTGGGCAAAACTGCGAGAGCTTATGTGGACAATCGGGGCT
ATTACCGCTGCGGCAAACAGTTCCACCATTGTAAGTGTCCCGCAGGACTATGCTGTGGTAAGAACAGCTACTGTGGAACCATCGATCTCTACTGCGGCGC
CCACAATTGTCAAGACTCTTGTCCTCCCTCGCCGTCTCCGGAGTCAAAGCAAGAAATGACCGGCGGCGGAAACAACATTGTCTTCATACCGGAGGATCTA
ATCAGCGACATCCTCGTCAGGCTACCCCGTTCAGCCACTGTCCGATTCCGCTTGGTCAGCAAAGAATGGGATAAGATCCTCTCCGATCCCAAATTCAACC
TCCTGATCCTCATCACGGGAGTCGGAGAAAATTACGAGACCATCATCGACCACGTCGACAACATTCACTATTCCTTGGCAACTACCAAACCCTCCGCGCA
GAGACACGTGGCAAAATTCCCCTATCCGACAGGATTCCCACGTGGAGCGACTATGTGCTGCGACGGAATATTCTGTATAAGCCGTATGAAGACCGAGTTA
GTGTCGGAGATTCTTCTGTGGAATCCGGCCACCTCCGAGAATATGTTCTTGCCGCTTTTCCCCTTCCGAATTCCTCGGACCAACACACACCCTCGCCGTG
CTTGA
AA sequence
>Lus10031533 pacid=23155777 polypeptide=Lus10031533 locus=Lus10031533.g ID=Lus10031533.BGIv1.0 annot-version=v1.0
MGTKMKKKLGILVAVLVLLLVGKTARAYVDNRGYYRCGKQFHHCKCPAGLCCGKNSYCGTIDLYCGAHNCQDSCPPSPSPESKQEMTGGGNNIVFIPEDL
ISDILVRLPRSATVRFRLVSKEWDKILSDPKFNLLILITGVGENYETIIDHVDNIHYSLATTKPSAQRHVAKFPYPTGFPRGATMCCDGIFCISRMKTEL
VSEILLWNPATSENMFLPLFPFRIPRTNTHPRRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47790 F-box and associated interacti... Lus10031533 0 1
Lus10037567 1.4 0.9918
Lus10015244 1.4 0.9928
Lus10033479 3.5 0.9850
AT3G07990 SCPL27 serine carboxypeptidase-like 2... Lus10036516 4.9 0.9765
AT5G51740 Peptidase family M48 family pr... Lus10031682 5.5 0.9675
AT4G31180 Class II aminoacyl-tRNA and bi... Lus10028557 6.0 0.9624
AT5G09550 GDP dissociation inhibitor fam... Lus10035634 10.4 0.9508
AT5G67620 unknown protein Lus10019264 13.6 0.9291
AT2G27990 HD PNF, BLH8 POUND-FOOLISH, BEL1-like homeo... Lus10040256 25.4 0.9623
Lus10027902 27.1 0.9557

Lus10031533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.