Lus10031546 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42570 232 / 2e-77 B-cell receptor-associated 31-like (.1)
AT1G11905 172 / 9e-54 B-cell receptor-associated protein 31-like (.1.2)
AT5G48660 122 / 2e-34 B-cell receptor-associated protein 31-like (.1)
AT3G07190 112 / 1e-30 B-cell receptor-associated protein 31-like (.1)
AT3G20450 102 / 1e-27 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015132 312 / 4e-109 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1)
Lus10030043 233 / 3e-78 AT5G42570 241 / 1e-81 B-cell receptor-associated 31-like (.1)
Lus10035283 209 / 9e-69 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Lus10020025 175 / 3e-55 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10011842 126 / 6e-36 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10022777 122 / 2e-34 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Lus10038188 122 / 3e-34 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Lus10000048 44 / 5e-06 AT1G11905 81 / 3e-20 B-cell receptor-associated protein 31-like (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G007200 215 / 7e-71 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1)
Potri.004G007900 209 / 2e-68 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1)
Potri.014G154800 187 / 1e-59 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
Potri.014G191500 134 / 4e-39 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.002G245300 132 / 2e-38 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
Potri.011G089100 125 / 1e-36 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05529 Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence
>Lus10031546 pacid=23155982 polypeptide=Lus10031546 locus=Lus10031546.g ID=Lus10031546.BGIv1.0 annot-version=v1.0
ATGATACAGCTTCTATATTCGGTGATACTCGCCGAAATGGCGCTGATTCTGGCGCTGCTGTTCAAGACGCCGCTGCGGAAGCTGGTGATCATGGCGCTGG
ATCGGGTCAAGCGAGGGAGAGGCCCCGTCATGGTGAAGACCGTCTCCGGTACGGTGTTCGTCGTCCTCTGCTCCAGCCTCTACAGTATGGTCACGATTCA
GAATCGCTCCATCGAGGCCGGCGCTCCCAATCCTACCGATCAGGTTCTCGAGTCCACACACCTGCTCGAAGCCTCTCTCATGGGGTTTCTGCTGTCTCTC
GCGCTGATGATCGACAGGCTACACCACTACATCAGGGAGCTCCGCCAACTAAGGAAGACGATGGAAGCCGCCAAGAAACAGACTCGAGGTCTCGACGATA
GCAAAAGCAGCAGCAGCAACAACCCAGATGAGCTCAAAGCACTAGGAGAAGAGGTTGCTATCCTACGCAGCAAGGTGAAGAAGATGGAAGCCGAATGTGA
AGCCAAGACAAAGGAAGCTAAGGCCGCAGCTGAGAAAGCTGGTGCTGTGAGGAAACAAACCGAAGGGTTTCTTCAAGACTACGAGCAATTACAAGAGGAC
AACCAGAACCTCCATAGCCAGATCGAGTCGTTAGAATCCGAGGGCAAGAAGGATATGTGA
AA sequence
>Lus10031546 pacid=23155982 polypeptide=Lus10031546 locus=Lus10031546.g ID=Lus10031546.BGIv1.0 annot-version=v1.0
MIQLLYSVILAEMALILALLFKTPLRKLVIMALDRVKRGRGPVMVKTVSGTVFVVLCSSLYSMVTIQNRSIEAGAPNPTDQVLESTHLLEASLMGFLLSL
ALMIDRLHHYIRELRQLRKTMEAAKKQTRGLDDSKSSSSNNPDELKALGEEVAILRSKVKKMEAECEAKTKEAKAAAEKAGAVRKQTEGFLQDYEQLQED
NQNLHSQIESLESEGKKDM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42570 B-cell receptor-associated 31-... Lus10031546 0 1
AT5G48630 Cyclin family protein (.1.2) Lus10002354 6.0 0.8328
AT5G63380 AMP-dependent synthetase and l... Lus10036994 9.5 0.8451
AT3G26935 DHHC-type zinc finger family p... Lus10022451 14.8 0.8786
AT4G36800 RCE1 RUB1 conjugating enzyme 1 (.1.... Lus10026038 25.1 0.8476
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10008868 26.7 0.8481
AT1G60890 Phosphatidylinositol-4-phospha... Lus10001377 30.5 0.7983
AT4G19040 EDR2 ENHANCED DISEASE RESISTANCE 2 ... Lus10012149 33.2 0.8294
AT1G15860 Domain of unknown function (DU... Lus10039198 41.2 0.8397
AT5G52580 RabGAP/TBC domain-containing p... Lus10027698 56.6 0.8116
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10009477 58.8 0.7843

Lus10031546 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.