Lus10031550 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27130 207 / 2e-70 Translation initiation factor SUI1 family protein (.1)
AT5G54760 205 / 9e-70 Translation initiation factor SUI1 family protein (.1.2.3)
AT1G54290 205 / 2e-69 Translation initiation factor SUI1 family protein (.1)
AT5G54940 162 / 1e-52 Translation initiation factor SUI1 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015124 226 / 9e-78 AT4G27130 209 / 8e-72 Translation initiation factor SUI1 family protein (.1)
Lus10039660 209 / 6e-71 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1)
Lus10027181 209 / 6e-71 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1)
Lus10021532 152 / 1e-48 AT5G54940 169 / 9e-56 Translation initiation factor SUI1 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G122700 204 / 3e-69 AT4G27130 217 / 5e-75 Translation initiation factor SUI1 family protein (.1)
Potri.011G134700 204 / 4e-69 AT4G27130 213 / 3e-73 Translation initiation factor SUI1 family protein (.1)
Potri.001G418600 203 / 7e-69 AT1G54290 218 / 2e-75 Translation initiation factor SUI1 family protein (.1)
Potri.007G122600 202 / 2e-68 AT4G27130 215 / 3e-74 Translation initiation factor SUI1 family protein (.1)
Potri.017G037100 183 / 4e-61 AT1G54290 187 / 2e-63 Translation initiation factor SUI1 family protein (.1)
Potri.010G151700 161 / 2e-52 AT5G54940 170 / 2e-56 Translation initiation factor SUI1 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01253 SUI1 Translation initiation factor SUI1
Representative CDS sequence
>Lus10031550 pacid=23155806 polypeptide=Lus10031550 locus=Lus10031550.g ID=Lus10031550.BGIv1.0 annot-version=v1.0
ATGTTGCAGCATTTGAAACCACTTGTTAGCAAACAAGCAAGCACACAAGGGCGTTTGGTTTGGTGGTTTCAGTTCTACGTTTTCCATCCAAAGTTCATGT
CTTTGGACGAACAGATCGCAACCCCTTTCGATCCTTTTGCTGATGCAAATGCTGAGGACTCGGGCGCTGGTACGAAAGAGTACGTCCACATCCGCATACA
GCAGCGAAATGGGAGGAAGAGCCTGACGACTGTGCAAGGGTTGAAGAAAGACTTTAGCTACAACAAGATACTCAAGCACCTAAAGAAGGAGTTCTGCTGT
AATGGTACTGTTGTCCAGGACCCTGAGTTAGGCCAGGTGATCCAGCTTCAAGGTGACCAGAGGAAGAACGCTTCCACGTTCCTAGTGCAGGCTGGAATTG
TGAAGAAGGATAACATCAAGATCCATGGTTTCTAA
AA sequence
>Lus10031550 pacid=23155806 polypeptide=Lus10031550 locus=Lus10031550.g ID=Lus10031550.BGIv1.0 annot-version=v1.0
MLQHLKPLVSKQASTQGRLVWWFQFYVFHPKFMSLDEQIATPFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKDFSYNKILKHLKKEFCC
NGTVVQDPELGQVIQLQGDQRKNASTFLVQAGIVKKDNIKIHGF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27130 Translation initiation factor ... Lus10031550 0 1
AT4G29070 Phospholipase A2 family protei... Lus10035314 2.4 0.8552
AT2G18050 HIS1-3 histone H1-3 (.1.2) Lus10014267 5.0 0.8467
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10000920 5.5 0.8624
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Lus10020392 5.7 0.8473
AT5G46030 unknown protein Lus10015293 8.1 0.8532
AT1G76570 Chlorophyll A-B binding family... Lus10015235 8.8 0.8442
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Lus10009571 13.2 0.8388
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Lus10025201 14.8 0.8175
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030583 16.2 0.8180
AT5G07840 PIA1 phytochrome interacting ankyri... Lus10018958 21.0 0.8364

Lus10031550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.