Lus10031551 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17880 216 / 9e-73 ATBTF3 basic transcription factor 3 (.1)
AT1G73230 201 / 7e-67 Nascent polypeptide-associated complex NAC (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015123 253 / 8e-88 AT1G17880 253 / 1e-87 basic transcription factor 3 (.1)
Lus10039661 238 / 1e-81 AT1G17880 253 / 2e-87 basic transcription factor 3 (.1)
Lus10027180 201 / 3e-67 AT1G17880 238 / 1e-81 basic transcription factor 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G078300 231 / 3e-79 AT1G73230 197 / 2e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.017G141100 223 / 8e-76 AT1G73230 196 / 3e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.015G029800 186 / 3e-61 AT1G17880 232 / 4e-79 basic transcription factor 3 (.1)
Potri.012G037900 183 / 6e-60 AT1G73230 225 / 1e-76 Nascent polypeptide-associated complex NAC (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Lus10031551 pacid=23155878 polypeptide=Lus10031551 locus=Lus10031551.g ID=Lus10031551.BGIv1.0 annot-version=v1.0
ATGAATCGGGAGAAGCTAATGAAGATGGCCGGCTCCGTTCGTACAGGAGGAAAGGGAACCGTCCGCAGAAAGAAGAAGGCTGTGCACAAATCGACCACCA
CCGACGACAAGAAGCTTCAGAGCACGCTGAAGAGGATAGGTGTCAACACCATCCCAGCTATTGAGGAAGTCAACATCTTCAAGGATGATTTGGTGATTCA
GTTTGTGAACCCTAAAGTTCAGGCCTCAGTTGTTGCCAACACTTGGGTTATCACTGGTTCTCCTCAGACCAGAAAACTTCAAGATATTCTTCCAGGAATC
ATCAACCAGCTTGGTCCGGACAACTTGGACAACCTCAAGAAGTTGGCTGAGCAGTTCCAAAAGGAGGCACCAGGCGCTACCTTGGGAGCAGTCCAGGAGG
AAGATGATGATGATGTCCCGGAACTGGTAGCAGGGGAGACATTTGAAGCTGCAGCAGCAGAAGAAACTAAAGCTTAA
AA sequence
>Lus10031551 pacid=23155878 polypeptide=Lus10031551 locus=Lus10031551.g ID=Lus10031551.BGIv1.0 annot-version=v1.0
MNREKLMKMAGSVRTGGKGTVRRKKKAVHKSTTTDDKKLQSTLKRIGVNTIPAIEEVNIFKDDLVIQFVNPKVQASVVANTWVITGSPQTRKLQDILPGI
INQLGPDNLDNLKKLAEQFQKEAPGATLGAVQEEDDDDVPELVAGETFEAAAAEETKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10031551 0 1
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10016432 1.7 0.8971
AT3G16780 Ribosomal protein L19e family ... Lus10023388 2.8 0.8601
AT5G06360 Ribosomal protein S8e family p... Lus10021274 3.7 0.8632
AT3G52570 alpha/beta-Hydrolases superfam... Lus10016992 4.2 0.8886
AT1G76010 Alba DNA/RNA-binding protein (... Lus10021844 4.7 0.8464
AT4G34670 Ribosomal protein S3Ae (.1) Lus10006609 4.9 0.8928
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10006914 5.3 0.8879
AT1G20370 Pseudouridine synthase family ... Lus10005641 5.5 0.8695
AT5G52660 MYB Homeodomain-like superfamily p... Lus10038846 6.9 0.8350
AT1G60080 3'-5'-exoribonuclease family p... Lus10021789 6.9 0.8456

Lus10031551 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.