Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26910 209 / 3e-70 RPL10B ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) AT1G14320 209 / 5e-70 RPL10A, RPL10, SAC52 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2) AT1G66580 197 / 3e-65 RPL10C, SAG24 ribosomal protein L10 C, senescence associated gene 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015106 [exp] 248 / 1e-86 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10012113 [exp] 242 / 2e-84 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10010429 [exp] 242 / 2e-84 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10031002 [exp] 239 / 4e-83 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10035401 [exp] 238 / 4e-83 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10034092 [exp] 225 / 7e-78 AT1G26910 216 / 7e-73 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10003055 [exp] 115 / 9e-35 AT1G26910 135 / 2e-41 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G131900 [exp] 226 / 9e-77 AT1G26910 410 / 6e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.013G159600 [exp] 224 / 6e-76 AT1G26910 411 / 3e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.013G159301 [exp] 134 / 1e-40 AT1G14320 222 / 2e-73 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00252 [flax] [poplar] Ribosomal_L16 Ribosomal protein L16p/L10e
Representative CDS sequence Show only first row Show all	>Lus10031568 pacid=23155822 polypeptide=Lus10031568 locus=Lus10031568.g ID=Lus10031568.BGIv1.0 annot-version=v1.0 ATGCTTTCGTGTGCCGGAGCTGATAGGCTCCAGACCGGTATGAGGGGTGCCTTCGGTAAGCCTCAAGGTGTGTGTGCTAGGGTTGCAATTGGTCAGGTTC TTTTATCAGTACGTTGCAAGGACAGCAACAGTCAGCATGCTCAGGAGGCTCTTCGTCGCGCCAAGTTCAAGTTCCCCGGTCGTCAGAAGATCATCATCAG CAGGAAATGGGGCTTCACTAAGTTCAACCGAGCTGACTATGTCAAGTTGAAGCAAGAAAACAGGATTATGCCTGATGGTGTCAATGCTAAGCTTCTTGGA TGCCATGGGCCCTTGGCCAACAGACAACCCGGAAGAGCATTCGCACCAACTGCCACCGCATAG
AA sequence Show only first row Show all	>Lus10031568 pacid=23155822 polypeptide=Lus10031568 locus=Lus10031568.g ID=Lus10031568.BGIv1.0 annot-version=v1.0 MLSCAGADRLQTGMRGAFGKPQGVCARVAIGQVLLSVRCKDSNSQHAQEALRRAKFKFPGRQKIIISRKWGFTKFNRADYVKLKQENRIMPDGVNAKLLG CHGPLANRQPGRAFAPTATA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031568 [exp]	0	1
					Lus10027105 [exp]	2.0	0.8279
AT2G03170		ASK14	SKP1-like 14 (.1)		Lus10031171 [exp]	5.6	0.8397
AT1G11240			unknown protein		Lus10011247 [exp]	13.7	0.8323
AT1G16740			Ribosomal protein L20 (.1)		Lus10033326 [exp]	14.1	0.8075
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10014843 [exp]	15.6	0.7861
AT4G25340		ATFKBP53	FK506 BINDING PROTEIN 53 (.1.2...		Lus10038905 [exp]	15.7	0.7463
AT5G45190			Cyclin family protein (.1.2)		Lus10038329 [exp]	16.0	0.8137
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10005380 [exp]	16.5	0.7936
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10009889 [exp]	17.7	0.7815
AT1G71430			unknown protein		Lus10040114 [exp]	18.3	0.7786

Compare expression of checked genes

Lus10031568 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.