Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21890 96 / 1e-26 CO B-box type zinc finger family protein (.1) AT4G15248 90 / 3e-24 CO B-box type zinc finger family protein (.1) AT4G27310 76 / 6e-18 CO B-box type zinc finger family protein (.1) AT5G54470 74 / 2e-17 CO B-box type zinc finger family protein (.1) AT3G21150 64 / 2e-13 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) AT1G73870 57 / 2e-10 CO COL7 B-box type zinc finger protein with CCT domain (.1) AT2G33500 55 / 8e-10 CO COL14 B-box type zinc finger protein with CCT domain (.1.2) AT1G25440 55 / 8e-10 CO COL16 B-box type zinc finger protein with CCT domain (.1) AT1G68520 55 / 1e-09 CO COL6 B-box type zinc finger protein with CCT domain (.1) AT5G15840 54 / 2e-09 CO FG, CO CONSTANS, B-box type zinc finger protein with CCT domain (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015097 [exp] 225 / 9e-78 AT4G15248 94 / 5e-26 B-box type zinc finger family protein (.1) Lus10039694 [exp] 130 / 5e-40 AT4G15248 108 / 1e-31 B-box type zinc finger family protein (.1) Lus10027151 [exp] 127 / 6e-39 AT4G15248 109 / 7e-32 B-box type zinc finger family protein (.1) Lus10031593 [exp] 73 / 6e-17 AT4G27310 119 / 2e-33 B-box type zinc finger family protein (.1) Lus10033751 [exp] 72 / 1e-16 AT4G27310 114 / 9e-32 B-box type zinc finger family protein (.1) Lus10018513 [exp] 67 / 2e-14 AT4G27310 117 / 3e-32 B-box type zinc finger family protein (.1) Lus10039727 [exp] 67 / 3e-14 AT5G54470 118 / 1e-32 B-box type zinc finger family protein (.1) Lus10033380 [exp] 64 / 5e-13 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Lus10034830 [exp] 62 / 2e-12 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G121100 [exp] 121 / 2e-36 AT4G15248 108 / 2e-31 B-box type zinc finger family protein (.1) Potri.017G039400 [exp] 110 / 2e-32 AT4G15248 100 / 3e-28 B-box type zinc finger family protein (.1) Potri.013G150500 [exp] 74 / 3e-17 AT4G27310 114 / 1e-31 B-box type zinc finger family protein (.1) Potri.004G027100 [exp] 71 / 5e-17 AT5G54470 97 / 4e-26 B-box type zinc finger family protein (.1) Potri.004G026900 [exp] 67 / 6e-15 AT4G27310 109 / 2e-30 B-box type zinc finger family protein (.1) Potri.011G039700 [exp] 66 / 3e-14 AT4G27310 105 / 3e-28 B-box type zinc finger family protein (.1) Potri.011G125400 [exp] 66 / 9e-14 AT5G54470 120 / 1e-32 B-box type zinc finger family protein (.1) Potri.001G414700 [exp] 66 / 1e-13 AT5G54470 126 / 2e-35 B-box type zinc finger family protein (.1) Potri.008G007000 [exp] 64 / 2e-13 AT3G21150 128 / 3e-36 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Potri.010G251800 [exp] 63 / 5e-13 AT3G21150 130 / 5e-37 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [flax] [poplar] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Lus10031583 pacid=23155946 polypeptide=Lus10031583 locus=Lus10031583.g ID=Lus10031583.BGIv1.0 annot-version=v1.0 ATGTGCAGAGGACTTCTGCAGCAAAGCAAAGCTGAGAGCTTCTGCAGAAAACCAGAAGCCGCCAGTAAAGTTGAGATCAGCTGTCTTGATGGTGTTTCTT CAGCATCAAGAAAGTGTGAGCTGTGTGAAGAAAGGGCAAGACTTTACTGTGAAGCTGACGATGCATATCTGTGCCAAGAATGTGACAGATACGTCCATGG TGCCAACTTCTTGGCTCTGAGACACGTTCGTTGCTTGCTGTGTAGCACCTGCCAAGGTTTCACTCAGAGGTACCTCGTCGGAGCTTTGACGGAGGTTGTG CTTCCAGGTACAGTGACGGATGAAGAACCAGAGGATTCAGTTGAATTGCCATTCCTATTTCTGTAA
AA sequence Show only first row Show all	>Lus10031583 pacid=23155946 polypeptide=Lus10031583 locus=Lus10031583.g ID=Lus10031583.BGIv1.0 annot-version=v1.0 MCRGLLQQSKAESFCRKPEAASKVEISCLDGVSSASRKCELCEERARLYCEADDAYLCQECDRYVHGANFLALRHVRCLLCSTCQGFTQRYLVGALTEVV LPGTVTDEEPEDSVELPFLFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G21890	CO		B-box type zinc finger family ...		Lus10031583 [exp]	0	1
AT4G16490			ARM repeat superfamily protein...		Lus10017562 [exp]	2.0	0.9407
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032481 [exp]	2.4	0.9401
AT4G16490			ARM repeat superfamily protein...		Lus10017563 [exp]	3.9	0.9271
AT5G51720			2 iron, 2 sulfur cluster bindi...		Lus10031686 [exp]	4.0	0.9243
AT5G51720			2 iron, 2 sulfur cluster bindi...		Lus10031105 [exp]	5.2	0.9173
AT4G25130		PMSR4	peptide met sulfoxide reductas...		Lus10032504 [exp]	5.9	0.9198
AT3G47070			unknown protein		Lus10040689 [exp]	6.9	0.9190
AT1G66080			unknown protein		Lus10010967 [exp]	7.0	0.9175
AT3G26430			GDSL-like Lipase/Acylhydrolase...		Lus10006224 [exp]	7.2	0.8991
AT3G26430			GDSL-like Lipase/Acylhydrolase...		Lus10036873 [exp]	8.4	0.8990

Compare expression of checked genes

Lus10031583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.