Lus10031586 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03210 446 / 9e-160 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT5G13870 313 / 3e-107 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT3G23730 303 / 3e-103 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G65730 299 / 1e-101 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G37800 297 / 6e-101 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT2G06850 291 / 2e-98 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT4G25810 290 / 5e-98 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT4G14130 290 / 7e-98 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 285 / 5e-96 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57550 284 / 8e-96 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018503 539 / 0 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10039715 533 / 0 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10033755 486 / 2e-174 AT4G03210 340 / 5e-117 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10003022 320 / 1e-109 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10011052 318 / 3e-108 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10040121 308 / 5e-105 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 304 / 2e-103 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10020773 299 / 1e-101 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 298 / 2e-101 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G125000 506 / 0 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.013G152400 502 / 0 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.007G008500 311 / 4e-106 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.001G071000 311 / 4e-106 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 308 / 5e-105 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.003G159700 307 / 8e-105 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.006G170001 298 / 2e-101 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 298 / 2e-101 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G170100 298 / 2e-101 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077320 293 / 3e-99 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10031586 pacid=23155882 polypeptide=Lus10031586 locus=Lus10031586.g ID=Lus10031586.BGIv1.0 annot-version=v1.0
ATGGCGGTCTCAATCTTCAGAATGTCTCTACTTGTTCAAGTTTTCATGGCATTTGCTATGGCGGGTATTGTTTCCTCTGCCAAATTCGACGAGCTGTTCC
AACCAAGCTGGGCTACTGACCATTTGATCTACGAAGGGGATCAGCTCAAGCTCAAGCTCGACAACTATTCTGGATCTGGGTTTCAGTCCAAGAGCAAGTA
CATGTTTGGGAAGGTCAACATTCAGATTAAGCTTGTGGAAGGAGACTCAGCTGGAACCGTCACTGCCTTCTACATGTCGTCGGAAGGTGCGAGTCACAAC
GAATTCGATTTCGAGTTCCTGGGTAACACTACAGGGGAGCCTTACGTGGTGCAGACGAATGTGTATGTCAATGGTGTTGGCAATAGGGAGCAAAGGTTGA
ACCTTTGGTTTGATCCCACCATGGATTTCCACAACTACTCCATCTTTTGGAACCCTAGCCAGGTCATATTCCTAGTGGACGATACACCGATAAGGCAGCA
CACAAACCTGGAGAACAAAGGGATCCCATTCCCCAAAGACCAGCCGATGGGAGTCTACAGCTCGATATGGAATGCAGACGACTGGGCGACCCAAGGAGGC
CGAATCAAGACCGATTGGACCCACGCTCCGTTCATCGCTTCCTACAGGGGTTTCGAAATCGATGCCTGTGAGATCCCTGCATCATCAGGGGTTTCAGCGG
CGGATTTGGCCAAGAACTGCACCAGCAATGCTGAGAAGAAGTACTGGTGGGATGAACCAATCTTGTCTGAGCTGAACTTGCACCAGAGCCATCAGTTGCT
TTGGGTTAAGGCCAACCACATGATCTATGACTACTGCACTGACAATTCTAGGTTCCCTGTGACACCTGAAGAGTGCCAGCATCACCATCATTAG
AA sequence
>Lus10031586 pacid=23155882 polypeptide=Lus10031586 locus=Lus10031586.g ID=Lus10031586.BGIv1.0 annot-version=v1.0
MAVSIFRMSLLVQVFMAFAMAGIVSSAKFDELFQPSWATDHLIYEGDQLKLKLDNYSGSGFQSKSKYMFGKVNIQIKLVEGDSAGTVTAFYMSSEGASHN
EFDFEFLGNTTGEPYVVQTNVYVNGVGNREQRLNLWFDPTMDFHNYSIFWNPSQVIFLVDDTPIRQHTNLENKGIPFPKDQPMGVYSSIWNADDWATQGG
RIKTDWTHAPFIASYRGFEIDACEIPASSGVSAADLAKNCTSNAEKKYWWDEPILSELNLHQSHQLLWVKANHMIYDYCTDNSRFPVTPEECQHHHH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G03210 XTH9, EXGT-A6, ... xyloglucan endotransglucosylas... Lus10031586 0 1
AT5G55280 ATFTSZ1-1, CPFT... CHLOROPLAST FTSZ, ARABIDOPSIS ... Lus10016579 1.4 0.9305
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Lus10011473 1.7 0.9127
AT4G35160 O-methyltransferase family pro... Lus10025098 5.5 0.8986
AT2G38560 RDO2, TFIIS REDUCED DORMANCY 2, transcript... Lus10025215 6.3 0.9040
AT1G02065 SBP SPL8 squamosa promoter binding prot... Lus10042882 6.5 0.8893
AT5G43960 Nuclear transport factor 2 (NT... Lus10023722 6.8 0.9181
AT4G21620 glycine-rich protein (.1.2) Lus10006730 6.9 0.8544
AT3G02710 ARM repeat superfamily protein... Lus10010958 7.4 0.8807
AT1G12570 Glucose-methanol-choline (GMC)... Lus10024487 11.0 0.8875
AT5G20060 alpha/beta-Hydrolases superfam... Lus10019438 12.2 0.8679

Lus10031586 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.