Lus10031597 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19130 144 / 1e-40 S-locus lectin protein kinase family protein (.1)
AT5G24080 90 / 9e-22 Protein kinase superfamily protein (.1)
AT1G34300 76 / 9e-17 lectin protein kinase family protein (.1)
AT4G00340 72 / 2e-15 RLK4 receptor-like protein kinase 4 (.1)
AT2G41890 68 / 6e-14 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1)
AT4G32300 65 / 4e-13 SD2-5 S-domain-2 5 (.1)
AT5G01020 59 / 6e-11 Protein kinase superfamily protein (.1)
AT4G02010 59 / 1e-10 Protein kinase superfamily protein (.1)
AT1G29720 57 / 5e-10 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G53430 56 / 9e-10 Leucine-rich repeat transmembrane protein kinase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033748 221 / 1e-68 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10018537 109 / 9e-32 AT2G19130 113 / 4e-30 S-locus lectin protein kinase family protein (.1)
Lus10039732 114 / 3e-30 AT2G19130 647 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10042266 114 / 5e-30 AT2G19130 775 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10039762 113 / 6e-30 AT2G19130 621 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10029802 107 / 9e-28 AT2G19130 729 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10026391 81 / 9e-21 AT2G19130 89 / 4e-22 S-locus lectin protein kinase family protein (.1)
Lus10013659 78 / 3e-18 AT5G20050 244 / 8e-79 Protein kinase superfamily protein (.1)
Lus10039315 78 / 2e-17 AT5G24080 667 / 0.0 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G119200 147 / 1e-41 AT2G19130 874 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.013G121000 143 / 2e-40 AT2G19130 863 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.013G149500 140 / 3e-39 AT2G19130 838 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.015G026300 89 / 3e-21 AT5G24080 684 / 0.0 Protein kinase superfamily protein (.1)
Potri.019G086400 79 / 7e-18 AT1G34300 904 / 0.0 lectin protein kinase family protein (.1)
Potri.019G086300 78 / 1e-17 AT1G34300 847 / 0.0 lectin protein kinase family protein (.1)
Potri.014G086900 78 / 1e-17 AT4G00340 862 / 0.0 receptor-like protein kinase 4 (.1)
Potri.013G115800 78 / 2e-17 AT1G34300 858 / 0.0 lectin protein kinase family protein (.1)
Potri.019G086200 77 / 3e-17 AT1G34300 918 / 0.0 lectin protein kinase family protein (.1)
Potri.013G115700 77 / 5e-17 AT1G34300 939 / 0.0 lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10031597 pacid=23155985 polypeptide=Lus10031597 locus=Lus10031596.g ID=Lus10031597.BGIv1.0 annot-version=v1.0
ATGCTGTTCGAGTTCGTGTCGGGAAGGAGGAACACCGACCAAACGGAAGATGGCAAGTTCCGATTCTTCCCGAGCTGGGCTGCTAGTGTAATATCCGGGG
GAGGCGATATTCTCGACTTGCTCGATCCGAGGCTGGAAGGGAATACTGACCGGGAAGAGCTTTCGCGAGTCTGTAATCTCGCTTTCTGGTGCATACAAGA
CAACGAGATGCAGAGGCCTTCGATGGGGCAGGCGGTTCAGGTCCTCGAGGGGATCTTGAACGTCGACCTGCCGCCTTTCCCCAGATCTCTCAAAGTGTTT
GAGGACAATCCGGAGAATGTCGTCTTCTTCAAGAACGAATCGTCCACTACCCAGAGCTCGCAAACACGAAGCAATCCTTCTGCTGCTTCGTCTCAGACAA
AGAACAGCACATCATCGAGTTCCTAA
AA sequence
>Lus10031597 pacid=23155985 polypeptide=Lus10031597 locus=Lus10031596.g ID=Lus10031597.BGIv1.0 annot-version=v1.0
MLFEFVSGRRNTDQTEDGKFRFFPSWAASVISGGGDILDLLDPRLEGNTDREELSRVCNLAFWCIQDNEMQRPSMGQAVQVLEGILNVDLPPFPRSLKVF
EDNPENVVFFKNESSTTQSSQTRSNPSAASSQTKNSTSSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19130 S-locus lectin protein kinase ... Lus10031597 0 1
AT3G53720 ATCHX20 cation/H+ exchanger 20, cation... Lus10024414 7.3 0.8127
Lus10018015 8.7 0.8121
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10028361 29.7 0.7721
AT3G19450 CAD-C, ATCAD4 CINNAMYL ALCOHOL DEHYDROGENASE... Lus10019811 37.5 0.7712
AT5G55340 MBOAT (membrane bound O-acyl t... Lus10022293 38.3 0.7580
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10004984 47.7 0.7368
AT5G17920 ATCIMS, ATMETS,... methionine synthesis 1, COBALA... Lus10008422 54.0 0.7654
AT1G76140 Prolyl oligopeptidase family p... Lus10021235 54.5 0.7496
AT3G53720 ATCHX20 cation/H+ exchanger 20, cation... Lus10025325 60.2 0.7560
AT2G38970 Zinc finger (C3HC4-type RING f... Lus10023527 65.6 0.7309

Lus10031597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.