Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27290 67 / 9e-14 S-locus lectin protein kinase family protein (.1) AT4G11900 67 / 1e-13 S-locus lectin protein kinase family protein (.1) AT4G21380 66 / 2e-13 ARK3 receptor kinase 3 (.1) AT1G61390 65 / 5e-13 S-locus lectin protein kinase family protein (.1.2) AT1G61550 63 / 2e-12 S-locus lectin protein kinase family protein (.1) AT1G61610 63 / 3e-12 S-locus lectin protein kinase family protein (.1) AT1G61380 62 / 6e-12 SD1-29 S-domain-1 29 (.1) AT1G61490 62 / 6e-12 S-locus lectin protein kinase family protein (.1) AT1G11280 60 / 2e-11 S-locus lectin protein kinase family protein (.1.2.3.4) AT1G61370 59 / 5e-11 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031603 [exp] 108 / 2e-28 AT4G03230 558 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033741 [exp] 107 / 8e-28 AT4G21380 576 / 0.0 receptor kinase 3 (.1) Lus10033743 [exp] 101 / 1e-25 AT4G21380 608 / 0.0 receptor kinase 3 (.1) Lus10025891 [exp] 86 / 3e-20 AT4G21380 593 / 0.0 receptor kinase 3 (.1) Lus10015424 [exp] 78 / 4e-19 AT1G11340 64 / 1e-12 S-locus lectin protein kinase family protein (.1) Lus10012955 [exp] 71 / 7e-16 AT2G19130 155 / 2e-43 S-locus lectin protein kinase family protein (.1) Lus10018516 [exp] 72 / 1e-15 AT1G11300 699 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10039731 [exp] 72 / 3e-15 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10028782 [exp] 71 / 3e-15 AT4G21380 649 / 0.0 receptor kinase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G121000 [exp] 72 / 1e-15 AT2G19130 863 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G126201 [exp] 71 / 3e-15 AT4G27290 833 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G020200 [exp] 71 / 4e-15 AT4G27290 517 / 3e-176 S-locus lectin protein kinase family protein (.1) Potri.011G128650 [exp] 69 / 5e-15 AT4G27290 225 / 8e-69 S-locus lectin protein kinase family protein (.1) Potri.010G017100 [exp] 70 / 7e-15 AT4G27290 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G017800 [exp] 70 / 8e-15 AT4G27290 462 / 1e-156 S-locus lectin protein kinase family protein (.1) Potri.010G025601 [exp] 68 / 1e-14 AT4G27290 234 / 2e-72 S-locus lectin protein kinase family protein (.1) Potri.001G412454 [exp] 68 / 2e-14 AT4G27290 316 / 9e-102 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 68 / 3e-14 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 68 / 3e-14 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [flax] [poplar] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Lus10031605 pacid=23155826 polypeptide=Lus10031605 locus=Lus10031605.g ID=Lus10031605.BGIv1.0 annot-version=v1.0 ATGGGTAATCCTCCATCAAAGCTTCTCTGCTTTCACTTCTTCACTGTTCTCCTTCTGTATATACACACCGGCGATGTCTTCGAGCTCGGTTTCTTCTATC CGGGCAACTTCTTTACACACTATGTGGGGATTTGGTACCATAATATTTCACCCCAAACTGTCGTCTGGGTTTTCAACAGCAACACAAACGATCTCATTTA CAACTTATCTACAGCGGAGCTGAGGGTCCAGAACGGAACCCTCATTTTTTACCCAGATCTCGATGCCGATATGGGAATGCATGACCCCCAACCCTTTGGT ACTGCACCATCGTCAAATCCGGTAGCTGTGCTTCAGGACAACGGCAATTTCGTGATAAGTGATTCTTATTCTACCACGTGGCAGAGCTTCGATTAA
AA sequence Show only first row Show all	>Lus10031605 pacid=23155826 polypeptide=Lus10031605 locus=Lus10031605.g ID=Lus10031605.BGIv1.0 annot-version=v1.0 MGNPPSKLLCFHFFTVLLLYIHTGDVFELGFFYPGNFFTHYVGIWYHNISPQTVVWVFNSNTNDLIYNLSTAELRVQNGTLIFYPDLDADMGMHDPQPFG TAPSSNPVAVLQDNGNFVISDSYSTTWQSFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61390			S-locus lectin protein kinase ...		Lus10031605 [exp]	0	1
AT4G26690		GDPDL3, GPDL2, ...	SHAVEN 3, MUTANT ROOT HAIR 5, ...		Lus10031604 [exp]	1.0	0.9361
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10007624 [exp]	7.9	0.8446
AT1G69850		NTL1, ATNRT1:2	nitrate transporter 1:2 (.1)		Lus10005417 [exp]	8.5	0.8339
AT3G55150		ATEXO70H1	exocyst subunit exo70 family p...		Lus10023455 [exp]	11.0	0.8253
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Lus10018390 [exp]	14.6	0.8272
AT2G20870			cell wall protein precursor, p...		Lus10039801 [exp]	18.5	0.8003
AT2G20870			cell wall protein precursor, p...		Lus10018569 [exp]	18.5	0.8054
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10005716 [exp]	20.0	0.7434
AT1G04730		CTF18	CHROMOSOME TRANSMISSION FIDELI...		Lus10032615 [exp]	21.5	0.7953
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	23.0	0.7776

Compare expression of checked genes

Lus10031605 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.