Lus10031611 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26667 343 / 1e-121 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT3G60180 304 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT4G25280 237 / 3e-79 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G60961 201 / 1e-66 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G35170 102 / 6e-25 adenylate kinase family protein (.1.2)
AT5G47840 99 / 8e-25 AMK2 adenosine monophosphate kinase (.1)
AT5G63400 89 / 3e-21 ADK1 adenylate kinase 1 (.1.2)
AT5G50370 85 / 8e-20 Adenylate kinase family protein (.1)
AT2G37250 84 / 4e-19 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 76 / 2e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033733 415 / 1e-148 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10019509 237 / 2e-80 AT5G26667 217 / 5e-73 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10031714 236 / 2e-73 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031135 219 / 4e-72 AT4G25280 263 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10009228 97 / 2e-24 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1)
Lus10037995 95 / 3e-24 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1)
Lus10003504 92 / 3e-22 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1)
Lus10009478 89 / 4e-22 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1)
Lus10036326 93 / 1e-21 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G043300 369 / 1e-131 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.002G134600 357 / 4e-127 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.014G104700 274 / 3e-94 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.015G129000 236 / 9e-79 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.019G078200 97 / 4e-24 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1)
Potri.018G113400 98 / 2e-23 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.013G103400 94 / 5e-23 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1)
Potri.008G046100 86 / 6e-20 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.010G215300 86 / 9e-20 AT2G37250 382 / 2e-134 adenosine kinase (.1)
Potri.015G092800 81 / 1e-18 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Lus10031611 pacid=23155900 polypeptide=Lus10031611 locus=Lus10031611.g ID=Lus10031611.BGIv1.0 annot-version=v1.0
ATGGGATCCGCCGTTGAAGCTGGAAACACGATAAGATATGCAAGTTTAGCTGAGAAGAAACCGACTGTTGTTTTCGTGTTGGGTGGCCCTGGCAGTGGAA
AGGGTACACAATGCACTAATATTGTGGAACACTTTGGTTATACTCATCTAAGCGCTGGTGATCTTCTTCGAGCAGAGATCAAGTCTGGATCTGAAAATGG
AACCATGATCCAGAACATGATTAAGGAGGGAAAGATTGTGCCCTCCGAGGTGACAATAAAGCTGCTCGAGAAGGCAATACTAGATAATGGAAATGACAAA
TTCCTTATTGATGGTTTCCCCCGTAATGAGGAAAACAGAGCTGCATTCGAAGCTGTTACCAAAATCGAGCCAGAATTCGTCCTCTTTTTCGATTGTCCTG
ATGAAGAGATGGAAAGGAGGATTCTGAGTAGGAACCAGGGAAGAGAAGATGATAACATTGAGACAATAAGGAAGCGTTTTAAGGTCTTTCTTGAGTCTAG
CCTTCCAGTGATTGAGTACTATGCTTCCAAGGGTAAAGTTAAGAAGGTTGATGCTGCCAAGTCTGTCGAAGAGGTTTTCAAGGCAGTGAAGGTCATTTTT
ACCCCGAAAGAGGATAAGGTAACACATCATAGGTGTGCTATCTTATAA
AA sequence
>Lus10031611 pacid=23155900 polypeptide=Lus10031611 locus=Lus10031611.g ID=Lus10031611.BGIv1.0 annot-version=v1.0
MGSAVEAGNTIRYASLAEKKPTVVFVLGGPGSGKGTQCTNIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLEKAILDNGNDK
FLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCPDEEMERRILSRNQGREDDNIETIRKRFKVFLESSLPVIEYYASKGKVKKVDAAKSVEEVFKAVKVIF
TPKEDKVTHHRCAIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26667 PYR6 P-loop containing nucleoside t... Lus10031611 0 1
AT2G27740 Family of unknown function (DU... Lus10019529 1.4 0.9059
AT5G11710 ENTH/VHS family protein (.1) Lus10007460 4.5 0.8903
AT5G42660 Protein of unknown function (D... Lus10032311 4.6 0.8658
AT4G34490 ATCAP1 cyclase associated protein 1 (... Lus10023575 6.3 0.8594
AT5G61240 Leucine-rich repeat (LRR) fami... Lus10026651 7.9 0.8318
AT5G42660 Protein of unknown function (D... Lus10024684 7.9 0.8625
AT4G34490 ATCAP1 cyclase associated protein 1 (... Lus10026338 7.9 0.8870
AT5G52560 ATUSP UDP-sugar pyrophosphorylase (.... Lus10028658 12.0 0.8520
AT5G08335 ATICMTB, ATSTE1... ARABIDOPSIS THALIANA ISOPRENYL... Lus10030398 12.4 0.8500
AT1G77580 Plant protein of unknown funct... Lus10010888 14.0 0.8551

Lus10031611 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.