Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 104 / 7e-31 Wound-responsive family protein (.1) AT4G10270 96 / 2e-27 Wound-responsive family protein (.1) AT2G14070 42 / 1e-05 wound-responsive protein-related (.1) AT4G33560 40 / 2e-05 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033731 [exp] 139 / 1e-44 AT4G10265 97 / 7e-28 Wound-responsive family protein (.1) Lus10039760 [exp] 116 / 2e-35 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 113 / 2e-34 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039753 [exp] 110 / 4e-33 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039752 [exp] 110 / 4e-33 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10039751 [exp] 107 / 4e-32 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039755 [exp] 106 / 2e-31 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 104 / 9e-31 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10018531 [exp] 104 / 1e-30 AT4G10265 119 / 1e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G148100 [exp] 92 / 4e-26 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.019G116932 [exp] 92 / 5e-26 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 92 / 5e-26 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G116500 [exp] 92 / 9e-26 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G117402 [exp] 90 / 4e-25 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 90 / 4e-25 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117632 [exp] 90 / 5e-25 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117201 [exp] 90 / 6e-25 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G116800 [exp] 90 / 6e-25 AT4G10270 95 / 3e-27 Wound-responsive family protein (.1) Potri.013G148000 [exp] 89 / 1e-24 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10031613 pacid=23155867 polypeptide=Lus10031613 locus=Lus10031613.g ID=Lus10031613.BGIv1.0 annot-version=v1.0 ATGGCTAGCATTTCGACGACGAGCAAGGCTTGGGGAGTGGCAGTGAGCATTGGAGCAGTGGAGGCACTGAAGGATCAGCTGGGGTTCTGCAGATGGAACC ACGTTATCAGATCAGCCCCGCAGTACGCTAGAAATTTCAAAGCCAGAGCAATTCCTCAAGCTTCCAAGCTTTCTTCTTCTCCTTCGGATGATGGTGGGTT GGTGAAGGAGGAATTAGCAGTGCAAAAGAGGAGGAGAACAGAGGAGTCTTTGGAGAAAGTTATGTACTTGAGCTGCTGGGGTCCCAAATAG
AA sequence Show only first row Show all	>Lus10031613 pacid=23155867 polypeptide=Lus10031613 locus=Lus10031613.g ID=Lus10031613.BGIv1.0 annot-version=v1.0 MASISTTSKAWGVAVSIGAVEALKDQLGFCRWNHVIRSAPQYARNFKARAIPQASKLSSSPSDDGGLVKEELAVQKRRRTEESLEKVMYLSCWGPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10031613 [exp]	0	1
AT2G42430	AS2	ASL18, LBD16	ASYMMETRIC LEAVES2-LIKE 18, la...		Lus10033872 [exp]	2.0	0.9152
AT5G22290	NAC	FSQ6, FAN, ANAC...	fructose-sensing quantitative ...		Lus10013316 [exp]	6.5	0.8886
AT4G10265			Wound-responsive family protei...		Lus10018533 [exp]	7.3	0.9205
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10013118 [exp]	9.2	0.8899
AT4G00910			Aluminium activated malate tra...		Lus10001528 [exp]	10.4	0.8994
AT3G05550			Hypoxia-responsive family prot...		Lus10033002 [exp]	13.5	0.9148
AT1G47710			Serine protease inhibitor (SER...		Lus10019009 [exp]	16.0	0.9082
AT5G54960		PDC2	pyruvate decarboxylase-2 (.1)		Lus10003384 [exp]	16.3	0.9128
AT5G62750			unknown protein		Lus10042178 [exp]	17.4	0.9133
AT5G51070		SAG15, CLPD, ER...	SENESCENCE ASSOCIATED GENE 15,...		Lus10012953 [exp]	17.5	0.8704

Compare expression of checked genes

Lus10031613 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.