Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40190 49 / 4e-08 LEW3 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) AT5G42000 40 / 4e-05 ORMDL family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028977 [exp] 57 / 1e-10 AT2G40190 751 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10008976 [exp] 55 / 2e-10 AT2G40190 192 / 1e-59 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10033219 [exp] 54 / 4e-10 AT5G42000 271 / 5e-95 ORMDL family protein (.1.2) Lus10007500 [exp] 53 / 3e-09 AT2G40190 745 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10023031 [exp] 52 / 3e-09 AT5G42000 270 / 1e-94 ORMDL family protein (.1.2) Lus10014773 [exp] 51 / 1e-08 AT2G40190 188 / 1e-55 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G095500 [exp] 54 / 1e-09 AT2G40190 735 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Potri.003G144600 [exp] 45 / 5e-07 AT5G42000 281 / 8e-99 ORMDL family protein (.1.2) Potri.001G086300 [exp] 41 / 3e-05 AT5G42000 273 / 1e-95 ORMDL family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031614 pacid=23156053 polypeptide=Lus10031614 locus=Lus10031614.g ID=Lus10031614.BGIv1.0 annot-version=v1.0 ATGGCGTTCGAAGACGAATTTGAAGGATTGCAGGTCTCGGCACAGATTGATAAACTTTGGCATATTCCTGACCGGATCAAGCGAGTCTATCCTCCTTGTG ATACATCAGGGCTACAGATATCTAATAGCCTCGCAAACAGCAGACTATCAAAATCCCATGCTGTTCTTCAACACGGTGGCGGTGTTCGTGCTGGTAGTGT CAAAGTTTCCGCACATGCGCAAAGTCCGGATATTCGGAATCAACGGCGATTTCTGATCCAAGAATTGAAAAGGATGTCCTTTTCACTTGGGTTAGAAACT TGA
AA sequence Show only first row Show all	>Lus10031614 pacid=23156053 polypeptide=Lus10031614 locus=Lus10031614.g ID=Lus10031614.BGIv1.0 annot-version=v1.0 MAFEDEFEGLQVSAQIDKLWHIPDRIKRVYPPCDTSGLQISNSLANSRLSKSHAVLQHGGGVRAGSVKVSAHAQSPDIRNQRRFLIQELKRMSFSLGLET

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10031614 [exp]	0	1
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10029816 [exp]	10.9	0.7749
AT4G05230			Ubiquitin-like superfamily pro...		Lus10018369 [exp]	14.5	0.6870
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10030995 [exp]	15.6	0.7241
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10020736 [exp]	16.7	0.7564
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10034957 [exp]	20.2	0.7107
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10031033 [exp]	21.2	0.7107
AT1G44750		ATPUP11	purine permease 11 (.1.2.3)		Lus10012606 [exp]	21.6	0.7229
AT1G70780			unknown protein		Lus10039287 [exp]	22.2	0.7107
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10034244 [exp]	23.0	0.7436
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Lus10005813 [exp]	24.0	0.7222

Compare expression of checked genes

Lus10031614 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.