Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16610 65 / 9e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010975 [exp] 136 / 4e-40 AT5G16610 377 / 8e-127 unknown protein Lus10000454 [exp] 0 / 1 AT5G16610 70 / 9e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G130400 [exp] 83 / 3e-20 AT5G16610 389 / 5e-129 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031615 pacid=23155815 polypeptide=Lus10031615 locus=Lus10031615.g ID=Lus10031615.BGIv1.0 annot-version=v1.0 ATGCAGTACGGCTGGACACCAAACACCGGGGTAGCGACGATGCTCAACTACTGCGACCGGGTAGTACACGACAGGAAGAGCGAGAAGGAAAGCTTGGAGT GGAAATCCAAAATAGGCAAGTTACTGATGGATGGATACAATGGCGGAACTGTCGTCTCCTCCACTCCCGCCGTCCAACTGGCAACAACAGAAGAATGCAG CTTCAATGGCAACTTTTCTGGAGTTAAGTTGGAGCTTGAATCTTAA
AA sequence Show only first row Show all	>Lus10031615 pacid=23155815 polypeptide=Lus10031615 locus=Lus10031615.g ID=Lus10031615.BGIv1.0 annot-version=v1.0 MQYGWTPNTGVATMLNYCDRVVHDRKSEKESLEWKSKIGKLLMDGYNGGTVVSSTPAVQLATTEECSFNGNFSGVKLELES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16610			unknown protein		Lus10031615 [exp]	0	1
AT5G59790			Domain of unknown function (DU...		Lus10030328 [exp]	12.1	0.6242
AT5G10530			Concanavalin A-like lectin pro...		Lus10042309 [exp]	13.3	0.6773
					Lus10039655 [exp]	19.0	0.6312
AT3G03470		CYP89A9	"cytochrome P450, family 87, s...		Lus10020354 [exp]	26.3	0.5517
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10037323 [exp]	30.4	0.6348
AT2G21660		CCR2, ATGRP7, G...	GLYCINE-RICH RNA-BINDING PROTE...		Lus10026344 [exp]	31.3	0.6331
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Lus10019446 [exp]	38.2	0.6464
AT1G27340			Galactose oxidase/kelch repeat...		Lus10003118 [exp]	42.0	0.5950
AT3G24850	B3		Domain of unknown function (DU...		Lus10038802 [exp]	43.5	0.6208
AT4G18425			Protein of unknown function (D...		Lus10015395 [exp]	43.9	0.6080

Compare expression of checked genes

Lus10031615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.