Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10270 74 / 5e-19 Wound-responsive family protein (.1) AT4G10265 69 / 3e-17 Wound-responsive family protein (.1) AT4G33560 44 / 4e-07 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033729 [exp] 115 / 2e-35 AT4G10270 94 / 8e-27 Wound-responsive family protein (.1) Lus10035008 [exp] 106 / 1e-29 AT1G18790 145 / 6e-42 RWP-RK domain containing 1, RWP-RK domain-containing protein (.1) Lus10039751 [exp] 81 / 1e-21 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039755 [exp] 81 / 1e-21 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10039752 [exp] 78 / 2e-20 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10018533 [exp] 77 / 4e-20 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039760 [exp] 77 / 5e-20 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 76 / 2e-19 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10018531 [exp] 75 / 3e-19 AT4G10265 119 / 1e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116500 [exp] 85 / 3e-23 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.013G148100 [exp] 84 / 4e-23 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.013G148000 [exp] 84 / 8e-23 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1) Potri.019G117632 [exp] 82 / 3e-22 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 82 / 5e-22 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 82 / 5e-22 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117201 [exp] 81 / 9e-22 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117301 [exp] 79 / 4e-21 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G116866 [exp] 79 / 4e-21 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117200 [exp] 79 / 1e-20 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10031616 pacid=23155894 polypeptide=Lus10031616 locus=Lus10031616.g ID=Lus10031616.BGIv1.0 annot-version=v1.0 ATGAGCTCAACGGGCAGAGCTTGGACGGCAGCAGTTGCAGTGGGAGCAGTGGAGGCTCTGAAAGACCAAGGATTTTGTAGATGGAATCACGCCATCCGAT CGATGCACCAACTCTCCAAGAACAAGATCAGGTCATCGTCATCGGCGTCAGTTTCCCGACAAGCTAAGGGAGCTACGCAAGTCCGTAGGATTGTGGAAGA AGAACAGAGGGGAAACAGAGCAGAGGAGTCTCTCGGAACTGTTATGTATTTGAGCTGA
AA sequence Show only first row Show all	>Lus10031616 pacid=23155894 polypeptide=Lus10031616 locus=Lus10031616.g ID=Lus10031616.BGIv1.0 annot-version=v1.0 MSSTGRAWTAAVAVGAVEALKDQGFCRWNHAIRSMHQLSKNKIRSSSSASVSRQAKGATQVRRIVEEEQRGNRAEESLGTVMYLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	0	1
AT4G10270			Wound-responsive family protei...		Lus10033729 [exp]	1.4	0.8591
AT3G14810		MSL5	mechanosensitive channel of sm...		Lus10005632 [exp]	2.2	0.8653
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10028837 [exp]	2.4	0.7829
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Lus10034397 [exp]	4.9	0.7544
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10021185 [exp]	5.2	0.8428
AT3G25710	bHLH	TMO5, BHLH32, b...	TARGET OF MONOPTEROS 5, basic ...		Lus10036175 [exp]	7.1	0.7698
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10009911 [exp]	11.0	0.8161
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10013128 [exp]	14.8	0.7377
AT1G20920			P-loop containing nucleoside t...		Lus10025525 [exp]	15.9	0.7571
AT4G09820	bHLH	BHLH42, TT8, bH...	TRANSPARENT TESTA 8, basic hel...		Lus10022032 [exp]	17.6	0.7482

Compare expression of checked genes

Lus10031616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.