Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28240 72 / 3e-18 Wound-responsive family protein (.1) AT4G10265 45 / 9e-08 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033728 [exp] 143 / 2e-46 AT4G28240 54 / 2e-11 Wound-responsive family protein (.1) Lus10039758 [exp] 119 / 1e-36 AT4G28240 59 / 5e-13 Wound-responsive family protein (.1) Lus10018535 [exp] 106 / 8e-32 AT4G28240 69 / 9e-17 Wound-responsive family protein (.1) Lus10027667 [exp] 99 / 5e-29 ND / Lus10039755 [exp] 54 / 5e-11 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 51 / 6e-10 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039760 [exp] 49 / 6e-09 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018532 [exp] 47 / 4e-08 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039751 [exp] 46 / 5e-08 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G147700 [exp] 105 / 4e-31 AT4G28240 63 / 1e-14 Wound-responsive family protein (.1) Potri.019G116300 [exp] 75 / 3e-19 AT4G28240 / Wound-responsive family protein (.1) Potri.019G116932 [exp] 61 / 2e-13 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 61 / 2e-13 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117402 [exp] 58 / 1e-12 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 58 / 1e-12 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117632 [exp] 57 / 2e-12 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G116500 [exp] 56 / 1e-11 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G117201 [exp] 54 / 4e-11 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117200 [exp] 54 / 6e-11 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10031617 pacid=23155819 polypeptide=Lus10031617 locus=Lus10031617.g ID=Lus10031617.BGIv1.0 annot-version=v1.0 ATGAATCAGCTGAACAGAGTATGGATGGCGGCCACCGTCGCAGTAGTACAAGGCCCTCACCCGGACCAGGGCGGTAGCAAATGGAGATCCGGCCTCCAGT CTCTCCACCACGGGAAGCGGCGGCTCTTCCCCTGCTCCGGCGACGACTCCGATCTCCGTCCGATTTCCGGAGCCACGATCGGGTCCGATCGGGTGGACGA CGGAGTGAGGCAGAGTGACGAGTCGCTCCGGCGAGTCATGTACCTCAACTGCTGGGGCCAGGGGTGA
AA sequence Show only first row Show all	>Lus10031617 pacid=23155819 polypeptide=Lus10031617 locus=Lus10031617.g ID=Lus10031617.BGIv1.0 annot-version=v1.0 MNQLNRVWMAATVAVVQGPHPDQGGSKWRSGLQSLHHGKRRLFPCSGDDSDLRPISGATIGSDRVDDGVRQSDESLRRVMYLNCWGQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28240			Wound-responsive family protei...		Lus10031617 [exp]	0	1
AT5G27830			unknown protein		Lus10029881 [exp]	5.7	0.9208
AT1G79720			Eukaryotic aspartyl protease f...		Lus10024098 [exp]	5.9	0.8932
AT5G60230		ATSEN2, SEN2	splicing endonuclease 2 (.1.2)		Lus10019074 [exp]	6.2	0.9118
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10039120 [exp]	7.2	0.8582
AT1G64280		SAI1, NIM1, NPR...	SALICYLIC ACID INSENSITIVE 1, ...		Lus10018756 [exp]	7.7	0.8692
AT1G10600		AMSH2	associated molecule with the S...		Lus10030875 [exp]	8.5	0.9106
AT3G15358			unknown protein		Lus10015439 [exp]	9.6	0.8625
AT3G04590	AT-hook		AT hook motif DNA-binding fami...		Lus10005518 [exp]	11.4	0.8871
AT5G10600		CYP81K2	"cytochrome P450, family 81, s...		Lus10009909 [exp]	11.5	0.9095
AT3G10760	GARP		Homeodomain-like superfamily p...		Lus10010442 [exp]	11.6	0.8580

Compare expression of checked genes

Lus10031617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.