Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20820 99 / 2e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033715 [exp] 154 / 4e-50 AT2G20820 104 / 9e-31 unknown protein Lus10037883 [exp] 99 / 1e-27 AT2G20820 83 / 8e-22 unknown protein Lus10038583 [exp] 89 / 5e-24 AT2G20820 75 / 1e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G109100 [exp] 112 / 2e-33 AT2G20820 97 / 9e-28 unknown protein Potri.013G146000 [exp] 106 / 2e-31 AT2G20820 76 / 3e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031625 pacid=23155957 polypeptide=Lus10031625 locus=Lus10031625.g ID=Lus10031625.BGIv1.0 annot-version=v1.0 ATGGCGATGGCTACACTCGCTGCAGCTCGTCGAGTCGCCGCACTCGGCCGATACTCATCCCCCAACGCTAACGTATTCGCCGCCTCCTCTCTCGTCCCCC GCCGCGGCCTTGCCGGCGCTGCAGATCACCATGGGACACCTAAGGTAAACTGTTGGTCGAAGCCAACGGATCCAGCTAACTGGAAGGAAGAACACTTTGT AATCGTCTCTCTAACTGGCTGGGGTCTCCTCATCTATGGGAGCTACAAGTTCTTCACCGGAGGGAAGAAGGAAGAGATGAGTAAGCATTGTAGCATGACT TCAGTTCCAGACTAA
AA sequence Show only first row Show all	>Lus10031625 pacid=23155957 polypeptide=Lus10031625 locus=Lus10031625.g ID=Lus10031625.BGIv1.0 annot-version=v1.0 MAMATLAAARRVAALGRYSSPNANVFAASSLVPRRGLAGAADHHGTPKVNCWSKPTDPANWKEEHFVIVSLTGWGLLIYGSYKFFTGGKKEEMSKHCSMT SVPD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20820			unknown protein		Lus10031625 [exp]	0	1
AT5G47030			ATPase, F1 complex, delta/epsi...		Lus10001082 [exp]	1.0	0.9556
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Lus10037680 [exp]	3.2	0.9363
AT5G51830			pfkB-like carbohydrate kinase ...		Lus10027401 [exp]	6.2	0.9468
AT5G08680			ATP synthase alpha/beta family...		Lus10034631 [exp]	7.1	0.9499
AT4G03120			C2H2 and C2HC zinc fingers sup...		Lus10011434 [exp]	7.7	0.9138
AT5G14040		PHT3;1	phosphate transporter 3;1 (.1)		Lus10041519 [exp]	9.2	0.9385
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10019137 [exp]	9.5	0.9241
AT5G43330		c-NAD-MDH2	cytosolic-NAD-dependent malate...		Lus10021870 [exp]	10.2	0.9222
AT5G13450		ATP5	delta subunit of Mt ATP syntha...		Lus10019706 [exp]	10.6	0.9246
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10012411 [exp]	12.1	0.9176

Compare expression of checked genes

Lus10031625 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.