Lus10031633 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02410 341 / 1e-119 cytochrome c oxidase assembly protein CtaG / Cox11 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017058 127 / 1e-35 AT1G02410 74 / 5e-15 cytochrome c oxidase assembly protein CtaG / Cox11 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G078500 328 / 1e-116 AT1G02410 316 / 2e-110 cytochrome c oxidase assembly protein CtaG / Cox11 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04442 CtaG_Cox11 Cytochrome c oxidase assembly protein CtaG/Cox11
Representative CDS sequence
>Lus10031633 pacid=23155909 polypeptide=Lus10031633 locus=Lus10031633.g ID=Lus10031633.BGIv1.0 annot-version=v1.0
ATGAACAGTAGTAGCAGTTTCAGCTTTAAGCGGTATTTTGCTGTAAGTGCAGCTGGTGGATCTTCTGCTACTGAGCAGAAGTCGAGGAAGACATTAATGT
ATCTTACGGGATTGGTTGTTGTGATGGTGGGTTGTACATATGCGGCGGTTCCTCTGTACAGAACATTTTGCCAAGCCACTGGTTATGGCGGTACTGTACA
GCGTCGTGAGACTGTTGAAGAGAAGATTTCACGGCATGCTAAAGACGGAACGGTGGCAATGAGAGAGATTGTGGTGCAGTTTAATGCTGATGTAGCTGAT
GGAATGCCATGGAAGTTTATTCCTACGCAAAGAGAGGTGAGAGTAAAACCCGGGGAAAGTGCCCTTGCATTTTATACAGCTGAGAATCGAAGTTCAACTC
CAATAACTGGTGTCTCCACATATAATGTTACTCCTATGAAGGCAGGTGTATACTTCAATAAAATACAGTGCTTCTGCTTTGAAGAACAACGTCTACTTCC
TGGGGAGCAGGTTGACATGCCTGTATTCTTTTACATAGATCCAGAGTTTGAAACGGATCCTAGGATGGATGGGATTAACAACATTATCTTGTCCTACACT
TTCTTCAAGATTTCAGATGAATAA
AA sequence
>Lus10031633 pacid=23155909 polypeptide=Lus10031633 locus=Lus10031633.g ID=Lus10031633.BGIv1.0 annot-version=v1.0
MNSSSSFSFKRYFAVSAAGGSSATEQKSRKTLMYLTGLVVVMVGCTYAAVPLYRTFCQATGYGGTVQRRETVEEKISRHAKDGTVAMREIVVQFNADVAD
GMPWKFIPTQREVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQVDMPVFFYIDPEFETDPRMDGINNIILSYT
FFKISDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02410 cytochrome c oxidase assembly ... Lus10031633 0 1
AT1G62640 KAS III, KASIII 3-ketoacyl-acyl carrier protei... Lus10004342 2.0 0.8044
AT3G63530 BB2, BB BIG BROTHER, RING/U-box superf... Lus10031842 4.2 0.7449
AT3G54860 ATVPS33 VACUOLAR PROTEIN SORTING 33, S... Lus10037969 5.7 0.7550
AT1G16570 UDP-Glycosyltransferase superf... Lus10026065 7.7 0.7760
AT1G77580 Plant protein of unknown funct... Lus10018164 9.5 0.7471
AT1G58280 Phosphoglycerate mutase family... Lus10032821 13.0 0.7261
AT4G35140 Transducin/WD40 repeat-like su... Lus10023993 13.7 0.7385
AT5G17620 unknown protein Lus10001340 17.4 0.7472
AT5G16000 NIK1 NSP-interacting kinase 1 (.1) Lus10034350 19.1 0.6973
AT4G01040 Glycosyl hydrolase superfamily... Lus10005946 20.7 0.7237

Lus10031633 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.