Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033697 [exp] 66 / 8e-15 AT4G03510 149 / 1e-44 RING membrane-anchor 1 (.1.2) Lus10018589 [exp] 45 / 6e-07 AT4G03510 154 / 9e-47 RING membrane-anchor 1 (.1.2) Lus10039821 [exp] 43 / 3e-06 AT4G03510 154 / 2e-46 RING membrane-anchor 1 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031641 pacid=23155829 polypeptide=Lus10031641 locus=Lus10031641.g ID=Lus10031641.BGIv1.0 annot-version=v1.0 ATGGGTTTGGATTTGTCAGGTCGGGGGCCGATTCCGGTGGTGGGGATGCTGGAGGAGATCATTTTCGCGGGAGGAGGGTTTGGGAGTAATGCGGCGACGG CGTATAGGGTGGCCGGAGGTGGTAGGGTGCGGCGGCAAATGATGGAGGCGGATCGATCGCTGAGCAGAGTGTGTTTCTTCCTCTGCTGCTGCGTTTTCGT GTGTCTCCTTCTATTTTGA
AA sequence Show only first row Show all	>Lus10031641 pacid=23155829 polypeptide=Lus10031641 locus=Lus10031641.g ID=Lus10031641.BGIv1.0 annot-version=v1.0 MGLDLSGRGPIPVVGMLEEIIFAGGGFGSNAATAYRVAGGGRVRRQMMEADRSLSRVCFFLCCCVFVCLLLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28270		ATRMA2	RING membrane-anchor 2 (.1)		Lus10031641 [exp]	0	1
AT1G23390			Kelch repeat-containing F-box ...		Lus10029127 [exp]	1.4	0.9575
AT1G23390			Kelch repeat-containing F-box ...		Lus10029128 [exp]	2.4	0.9265
AT2G19570		DESZ, AT-CDA1, ...	cytidine deaminase 1 (.1)		Lus10007654 [exp]	3.7	0.9059
AT3G27880			Protein of unknown function (D...		Lus10032145 [exp]	3.9	0.9148
AT3G23000		PKS7, ATSRPK1, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10039404 [exp]	6.6	0.8919
AT5G12300			Calcium-dependent lipid-bindin...		Lus10009693 [exp]	7.3	0.9144
AT5G13810			Glutaredoxin family protein (....		Lus10039537 [exp]	7.7	0.8850
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Lus10035011 [exp]	9.1	0.9269
AT2G39570		ACR9	ACT domain repeats 9, ACT doma...		Lus10005157 [exp]	11.0	0.8450
AT5G56980			unknown protein		Lus10014282 [exp]	15.0	0.8467

Compare expression of checked genes

Lus10031641 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.