Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28290 49 / 2e-09 unknown protein AT5G42110 46 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033693 [exp] 71 / 7e-18 AT4G28290 62 / 3e-14 unknown protein Lus10018592 [exp] 61 / 5e-14 AT4G28290 52 / 1e-10 unknown protein Lus10039825 [exp] 59 / 2e-13 AT4G28290 51 / 2e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G111501 [exp] 55 / 7e-12 AT4G28290 49 / 3e-09 unknown protein Potri.019G100601 [exp] 55 / 7e-12 AT4G28290 49 / 3e-09 unknown protein Potri.013G131900 [exp] 49 / 1e-09 AT4G28290 47 / 7e-09 unknown protein Potri.001G449633 [exp] 48 / 4e-09 AT4G28290 45 / 7e-08 unknown protein Potri.011G151900 [exp] 41 / 2e-06 AT5G42110 38 / 3e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031644 pacid=23155887 polypeptide=Lus10031644 locus=Lus10031644.g ID=Lus10031644.BGIv1.0 annot-version=v1.0 ATGAAGAAATCCGGCCTTCTCGCTGCTTCCTCCGCCGTCGCCGCCGCCGCATCTGCAACCGCCATCTCTCCTCCTCCTCCTCTTTCCTCTTCTCGTCAGG AGGGTGGTTCTGACAACGATCGGCGACAGAACAGGAAGCTGTCGGCGGCGGCGGACAAGTTTGCTCCGAGGTTTGACGGGCTGAGGTTTATCGAGACGTT GGTGACTGCTCATCGGTAG
AA sequence Show only first row Show all	>Lus10031644 pacid=23155887 polypeptide=Lus10031644 locus=Lus10031644.g ID=Lus10031644.BGIv1.0 annot-version=v1.0 MKKSGLLAASSAVAAAASATAISPPPPLSSSRQEGGSDNDRRQNRKLSAAADKFAPRFDGLRFIETLVTAHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28290			unknown protein		Lus10031644 [exp]	0	1
AT2G41290		SSL2	strictosidine synthase-like 2 ...		Lus10012095 [exp]	2.6	0.8994
AT5G23210		SCPL34	serine carboxypeptidase-like 3...		Lus10010190 [exp]	8.0	0.8694
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10033034 [exp]	11.7	0.8861
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Lus10013001 [exp]	12.0	0.8594
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10016685 [exp]	16.2	0.8787
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10028073 [exp]	17.6	0.8755
AT3G48420			Haloacid dehalogenase-like hyd...		Lus10016820 [exp]	19.0	0.8768
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10021496 [exp]	21.6	0.8746
AT2G33390			unknown protein		Lus10011781 [exp]	22.5	0.7973
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10025620 [exp]	27.5	0.8595

Compare expression of checked genes

Lus10031644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.