Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51740 107 / 9e-29 Peptidase family M48 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038897 [exp] 100 / 4e-26 AT5G51740 501 / 1e-176 Peptidase family M48 family protein (.1) Lus10015019 [exp] 99 / 9e-26 AT5G51740 498 / 4e-175 Peptidase family M48 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G131100 [exp] 109 / 1e-29 AT5G51740 565 / 0.0 Peptidase family M48 family protein (.1) Potri.002G162700 [exp] 37 / 0.0009 AT4G01320 744 / 0.0 Peptidase family M48 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [flax] [poplar] Peptidase_MA PF01435 [flax] [poplar] Peptidase_M48 Peptidase family M48
Representative CDS sequence Show only first row Show all	>Lus10031682 pacid=23180611 polypeptide=Lus10031682 locus=Lus10031682.g ID=Lus10031682.BGIv1.0 annot-version=v1.0 ATGGCAACTCACCGGCGAATGGTAGTGGTGGTGGACAAGCCAGATGTTAATGCGTTCTGTTTACCGGGTGGGAAGATTGTGGTGTTCACTGGTTTGCTTA AGCAATTCAAGAGTGATGCCGAGATAGCCACCATTGTTGGCCATGAGGTTGGGCATGCTGTGGCACAGCATACTGCTGAGAAGTTCTTCAAGCACTTGTG GATCGGCATTGTGCAATTGTGCTTGATCTTAAGCGAATTACCGGCGAAGGATGTTCAATGGATTCCCAATTTTCATGTGCAGGGAGGGGTGTTTTAA
AA sequence Show only first row Show all	>Lus10031682 pacid=23180611 polypeptide=Lus10031682 locus=Lus10031682.g ID=Lus10031682.BGIv1.0 annot-version=v1.0 MATHRRMVVVVDKPDVNAFCLPGGKIVVFTGLLKQFKSDAEIATIVGHEVGHAVAQHTAEKFFKHLWIGIVQLCLILSELPAKDVQWIPNFHVQGGVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51740			Peptidase family M48 family pr...		Lus10031682 [exp]	0	1
AT4G31180			Class II aminoacyl-tRNA and bi...		Lus10028557 [exp]	1.0	0.9998
					Lus10033479 [exp]	2.0	0.9962
AT4G20990		ATACA4, ACA4	A. THALIANA ALPHA CARBONIC ANH...		Lus10031027 [exp]	2.8	0.9829
AT5G52810			NAD(P)-binding Rossmann-fold s...		Lus10043176 [exp]	3.0	0.9409
					Lus10015244 [exp]	3.0	0.9890
AT3G07990		SCPL27	serine carboxypeptidase-like 2...		Lus10036516 [exp]	3.9	0.9802
AT1G65820			microsomal glutathione s-trans...		Lus10020792 [exp]	5.3	0.9461
AT1G47790			F-box and associated interacti...		Lus10031533 [exp]	5.5	0.9675
AT5G26330			Cupredoxin superfamily protein...		Lus10006683 [exp]	6.3	0.9254
AT1G07520	GRAS		GRAS family transcription fact...		Lus10037757 [exp]	13.4	0.8629

Compare expression of checked genes

Lus10031682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.