Lus10031699 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18100 223 / 1e-76 Ribosomal protein L32e (.1)
AT5G46430 221 / 1e-75 Ribosomal protein L32e (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020410 246 / 1e-85 AT4G18100 242 / 3e-84 Ribosomal protein L32e (.1)
Lus10009591 245 / 3e-84 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1)
Lus10012195 243 / 3e-84 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10007541 243 / 3e-84 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10011970 241 / 1e-83 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10004589 239 / 4e-83 AT4G18100 247 / 4e-86 Ribosomal protein L32e (.1)
Lus10031120 246 / 9e-82 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G353900 229 / 4e-79 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.014G191000 229 / 4e-79 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.002G249000 226 / 4e-78 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Potri.011G078200 224 / 4e-77 AT4G18100 225 / 2e-77 Ribosomal protein L32e (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01655 Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence
>Lus10031699 pacid=23180590 polypeptide=Lus10031699 locus=Lus10031699.g ID=Lus10031699.BGIv1.0 annot-version=v1.0
ATGGCGGTTCCTTTGCTGACGAAGAAGATCATCAAGAAGAGGGTCAAGGCGTTCAAGAGGCCTCAGAGTGATCGCAAGCACTGTGTCAAGGAGAACTGGA
GAAGGCCAAAGGGTATCGACTCAAGGGTCAGGAGAAAGTTCAAGGGTGTGACGTTGATGCCCAACATTGGTTACGGCTCAGACAAGAAAACCCGACACTA
TCTTCCCAACGGTTTCAAGAAGTTCGTCGTGCACAACGTTAAGGAGCTTGAGGTTCTCATGATGCACAACAGGACCTACTGTGCCGAGATCGCACATGAT
GTCGCTACCAGGAAGAGGAAGGACATTGTTGAGCGTGCTGCACAGCTGGACATCGTTGTTACCAACAAGCTTGCTAGGCTCAGGAGCCAGGAAGACGAGT
AG
AA sequence
>Lus10031699 pacid=23180590 polypeptide=Lus10031699 locus=Lus10031699.g ID=Lus10031699.BGIv1.0 annot-version=v1.0
MAVPLLTKKIIKKRVKAFKRPQSDRKHCVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLMMHNRTYCAEIAHD
VATRKRKDIVERAAQLDIVVTNKLARLRSQEDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18100 Ribosomal protein L32e (.1) Lus10031699 0 1
AT3G22660 rRNA processing protein-relate... Lus10031120 1.0 0.9204
AT2G19740 Ribosomal protein L31e family ... Lus10018032 1.4 0.9170
AT2G03870 EMB2816 EMBRYO DEFECTIVE 2816, Small n... Lus10035639 2.0 0.8552
AT3G23620 Ribosomal RNA processing Brix ... Lus10027714 4.6 0.8705
AT1G55205 unknown protein Lus10024700 5.5 0.8445
AT1G18850 unknown protein Lus10023616 5.7 0.8112
AT2G18110 Translation elongation factor... Lus10013555 7.1 0.8086
AT5G28060 Ribosomal protein S24e family ... Lus10004123 9.5 0.8551
AT2G20450 Ribosomal protein L14 (.1) Lus10024918 10.2 0.8385
AT2G19740 Ribosomal protein L31e family ... Lus10042028 13.3 0.8381

Lus10031699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.