Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51560 259 / 1e-83 Leucine-rich repeat protein kinase family protein (.1) AT2G45340 191 / 1e-57 Leucine-rich repeat protein kinase family protein (.1) AT4G22730 162 / 3e-47 Leucine-rich repeat protein kinase family protein (.1) AT1G16670 99 / 8e-25 Protein kinase superfamily protein (.1) AT1G53420 99 / 1e-24 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29740 97 / 9e-24 Leucine-rich repeat transmembrane protein kinase (.1) AT3G14840 96 / 1e-23 Leucine-rich repeat transmembrane protein kinase (.1.2) AT5G40380 96 / 3e-23 CRK42 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1) AT5G01890 95 / 3e-23 Leucine-rich receptor-like protein kinase family protein (.1) AT3G56370 95 / 4e-23 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031703 [exp] 321 / 3e-107 AT5G51560 851 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10031123 [exp] 315 / 7e-105 AT5G51560 855 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10004333 [exp] 177 / 1e-52 AT4G22730 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10028916 [exp] 172 / 1e-50 AT4G22730 749 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10004032 [exp] 163 / 2e-47 AT2G45340 747 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030279 [exp] 160 / 1e-46 AT2G45340 648 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10028149 [exp] 100 / 2e-25 AT1G16670 434 / 6e-152 Protein kinase superfamily protein (.1) Lus10006056 [exp] 101 / 3e-25 AT1G71830 731 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10025703 [exp] 100 / 3e-25 AT5G63710 358 / 3e-118 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G130100 [exp] 273 / 4e-89 AT5G51560 940 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.012G128700 [exp] 268 / 6e-87 AT5G51560 906 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.014G068700 [exp] 206 / 3e-63 AT2G45340 831 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.002G147000 [exp] 193 / 9e-59 AT2G45340 808 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.001G117800 [exp] 166 / 1e-48 AT4G22730 847 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.003G115100 [exp] 147 / 2e-41 AT4G22730 788 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.016G137000 [exp] 100 / 4e-25 AT3G56370 1116 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.001G438400 [exp] 99 / 6e-25 AT1G16670 529 / 0.0 Protein kinase superfamily protein (.1) Potri.010G043900 [exp] 99 / 1e-24 AT1G70530 805 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1) Potri.013G091000 [exp] 99 / 1e-24 AT3G56370 1227 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10031702 pacid=23180687 polypeptide=Lus10031702 locus=Lus10031702.g ID=Lus10031702.BGIv1.0 annot-version=v1.0 ATGAATTATCCGTTGTTGTTTATGTTAATTATTGGCAGCTACAAACCCAACAAGCCATCCATAATCCACCAGAACATAACAGCAGAGAAAATCCTGATAG ACAAAAGGCACAACCCAATGGTATCAGGGTCAGGCCTGCAGAGCCTCCTGACAAACGACGCCGTTTTCTCAGCACTCAAGGCCAGTGCAGCAATGGGGTA CATGGCTCCGGAGTACTCGACTACGGGGAAGTTCACGGACAAGAGCGACGTGTACGCATTCGGAGTGGTCGTGTTCCAGGTCCTATCCGGGAAGCGTAAG GTCTCGAATCTGATCCGATTAGGTGCTGAGTCGTGTCGTTTCGAGGACTACTTGGATGCCAACCTCAAAGGGAGGTTCTTTGAGTATGAAGCTGCTAAGC TTGCTAGGATTGCATGGATTTGTACCCACGAGTCACCTGTTGAGAGGCCTTCCATGGAAGCTGTTGTTCAGGAACTGGGGAACTGTAGTAGTTGCATTTA G
AA sequence Show only first row Show all	>Lus10031702 pacid=23180687 polypeptide=Lus10031702 locus=Lus10031702.g ID=Lus10031702.BGIv1.0 annot-version=v1.0 MNYPLLFMLIIGSYKPNKPSIIHQNITAEKILIDKRHNPMVSGSGLQSLLTNDAVFSALKASAAMGYMAPEYSTTGKFTDKSDVYAFGVVVFQVLSGKRK VSNLIRLGAESCRFEDYLDANLKGRFFEYEAAKLARIAWICTHESPVERPSMEAVVQELGNCSSCI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51560			Leucine-rich repeat protein ki...		Lus10031702 [exp]	0	1
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10018520 [exp]	2.2	0.9614
AT2G26580	YABBY	YAB5	YABBY5, plant-specific transcr...		Lus10030105 [exp]	3.9	0.9411
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10005313 [exp]	4.2	0.9251
AT3G05470			Actin-binding FH2 (formin homo...		Lus10004505 [exp]	4.5	0.9507
AT2G45190	YABBY	FIL, YAB1, AFO	YABBY1, FILAMENTOUS FLOWER, AB...		Lus10036496 [exp]	5.7	0.9504
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10009336 [exp]	7.5	0.9205
AT5G62230		ERL1	ERECTA-like 1 (.1.2)		Lus10031108 [exp]	9.6	0.9417
AT1G02065	SBP	SPL8	squamosa promoter binding prot...		Lus10028181 [exp]	13.0	0.9248
AT5G62230		ERL1	ERECTA-like 1 (.1.2)		Lus10031689 [exp]	13.6	0.9262
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10031608 [exp]	13.9	0.9304

Compare expression of checked genes

Lus10031702 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.