Lus10031704 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00100 266 / 4e-93 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
AT3G60770 263 / 3e-92 Ribosomal protein S13/S15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031124 282 / 1e-99 AT4G00100 267 / 9e-94 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Lus10038908 282 / 2e-99 AT4G00100 289 / 4e-102 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Lus10027192 282 / 2e-99 AT4G00100 289 / 4e-102 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G130000 273 / 5e-96 AT4G00100 283 / 7e-100 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Potri.002G146800 269 / 2e-94 AT3G60770 287 / 1e-101 Ribosomal protein S13/S15 (.1)
Potri.012G128600 267 / 1e-93 AT4G00100 288 / 6e-102 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Potri.014G068600 266 / 2e-93 AT3G60770 291 / 4e-103 Ribosomal protein S13/S15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0600 S15_NS1 PF00312 Ribosomal_S15 Ribosomal protein S15
CL0600 PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Representative CDS sequence
>Lus10031704 pacid=23180617 polypeptide=Lus10031704 locus=Lus10031704.g ID=Lus10031704.BGIv1.0 annot-version=v1.0
ATGGGTCGCATGCACTCCAGAGGAAAGGGTATTTCAGCTTCAGCTCTGCCCTACAAAAGAACTCCCCCGAGCTGGCTCAAGATCTCTTCTCAGGATGTGG
AGGAGAACATCTGTAAGTTTGCGAAGAAGGGTTTGACTCCATCGCAGATTGGTGTCATCCTTCGTGACTCTCATGGCATTGCTCAGGTCAGGAGTGTGAC
CGGTAGCAAGATCCTTCGCATCCTCAAAGCAAGTGGACTTGCCCCTGAAATCCCTGAGGATCTGTACCATCTCATCAAGAAGGCTGTGGCCATCAGGAAG
CATTTGGAGAGGAACAGGAAGGACAAGGACTCCAAGTTCCGTTTGATTCTTGTTGAGAGCAGAATCCACAGGCTTGCCCGTTACTACAAGAAGACCAAGA
AGCTTCCCCCAGTCTGGAAATAG
AA sequence
>Lus10031704 pacid=23180617 polypeptide=Lus10031704 locus=Lus10031704.g ID=Lus10031704.BGIv1.0 annot-version=v1.0
MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVRSVTGSKILRILKASGLAPEIPEDLYHLIKKAVAIRK
HLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10031704 0 1
AT2G40510 Ribosomal protein S26e family ... Lus10034223 2.4 0.9658
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10000946 2.4 0.9722
AT2G31610 Ribosomal protein S3 family pr... Lus10012857 5.3 0.9664
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10005286 8.7 0.9650
AT3G17910 EMB3121, SURF1 SURFEIT 1, EMBRYO DEFECTIVE 31... Lus10031335 8.7 0.9251
AT3G57290 ATINT6, ATEIF3E... eukaryotic translation initiat... Lus10018035 8.8 0.9524
AT5G04430 BTR1S, BTR1L, B... BINDING TO TOMV RNA 1S \(SHORT... Lus10037932 8.9 0.9559
AT3G05590 RPL18 ribosomal protein L18 (.1) Lus10015198 11.0 0.9622
AT4G27585 SPFH/Band 7/PHB domain-contain... Lus10015597 11.5 0.9521
AT5G04430 BTR1S, BTR1L, B... BINDING TO TOMV RNA 1S \(SHORT... Lus10038665 11.7 0.9354

Lus10031704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.