Lus10031707 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02000 89 / 1e-21 GAE2 UDP-D-glucuronate 4-epimerase 2 (.1)
AT3G23820 87 / 8e-21 GAE6 UDP-D-glucuronate 4-epimerase 6 (.1)
AT4G00110 87 / 8e-21 GAE3 UDP-D-glucuronate 4-epimerase 3 (.1)
AT2G45310 86 / 1e-20 GAE4 UDP-D-glucuronate 4-epimerase 4 (.1)
AT4G12250 79 / 7e-18 GAE5 UDP-D-glucuronate 4-epimerase 5 (.1)
AT4G30440 71 / 5e-15 GAE1 UDP-D-glucuronate 4-epimerase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038911 92 / 1e-23 AT1G02000 440 / 8e-156 UDP-D-glucuronate 4-epimerase 2 (.1)
Lus10027195 92 / 1e-23 AT1G02000 441 / 4e-156 UDP-D-glucuronate 4-epimerase 2 (.1)
Lus10016640 94 / 4e-23 AT3G23820 746 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Lus10022552 92 / 1e-22 AT3G23820 742 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Lus10030281 87 / 7e-21 AT4G00110 753 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10000787 87 / 8e-21 AT4G00110 731 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10023077 86 / 1e-20 AT1G02000 244 / 2e-77 UDP-D-glucuronate 4-epimerase 2 (.1)
Lus10015876 86 / 2e-20 AT4G00110 751 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10009288 86 / 3e-20 AT4G00110 704 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G128200 98 / 6e-25 AT1G02000 544 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.017G059100 86 / 1e-20 AT3G23820 724 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Potri.002G146500 85 / 4e-20 AT1G02000 724 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.014G068400 84 / 7e-20 AT1G02000 714 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.003G114600 84 / 8e-20 AT4G12250 587 / 0.0 UDP-D-glucuronate 4-epimerase 5 (.1)
Potri.002G116750 77 / 9e-19 AT2G45310 209 / 6e-67 UDP-D-glucuronate 4-epimerase 4 (.1)
Potri.018G100400 70 / 8e-15 AT4G30440 771 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Potri.006G178500 67 / 8e-14 AT4G30440 757 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Potri.001G320000 0 / 1 AT3G23820 714 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
PFAM info
Representative CDS sequence
>Lus10031707 pacid=23180749 polypeptide=Lus10031707 locus=Lus10031707.g ID=Lus10031707.BGIv1.0 annot-version=v1.0
ATGAAATATCGCATAAATAAAGGCGATGAACACGACAAATCGATCATCAATCGCCTATTTAACATCTACGAAGGACCCAATGGGTTCACGGTGGCTAGGG
ATTTCACCTACATCGACGATGTAGTGAAGGGGTGTTTGGCGACGGTGGACACGGCGGGGAAGACCACCGGCGGCGGAGGAGTGAAGAAAGGAGAAGCTCA
GTTGAGGGTTTATAACTTGGGGAATACTTCGCCTGTTCCCGTGGGGGAGCTGGTGAGTATATTGGAGAAGCTGTTGAAGGTTAAGGCGAAGAAGAAGGTG
ACGCCGATGCCGGAGAACGGCGACGTTTGTTCACTCATGCGAATGTTAGTTTGGCGAAGAGGGATTTTGGGTACGAGCCAACCACCGTTTTGGAGACTGG
GTTGA
AA sequence
>Lus10031707 pacid=23180749 polypeptide=Lus10031707 locus=Lus10031707.g ID=Lus10031707.BGIv1.0 annot-version=v1.0
MKYRINKGDEHDKSIINRLFNIYEGPNGFTVARDFTYIDDVVKGCLATVDTAGKTTGGGGVKKGEAQLRVYNLGNTSPVPVGELVSILEKLLKVKAKKKV
TPMPENGDVCSLMRMLVWRRGILGTSQPPFWRLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10031707 0 1
AT1G60370 F-box and associated interacti... Lus10008162 1.7 0.8175
AT5G06540 Pentatricopeptide repeat (PPR)... Lus10031424 4.5 0.8384
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023453 4.9 0.8249
AT4G23410 TET5 tetraspanin5 (.1) Lus10036518 4.9 0.8047
AT4G13750 EMB2597, NOV NO VEIN, EMBRYO DEFECTIVE 2597... Lus10037831 4.9 0.7538
AT1G31860 HISN2, AT-IE HISTIDINE BIOSYNTHESIS 2, hist... Lus10043483 10.6 0.8013
AT5G08110 nucleic acid binding;ATP-depen... Lus10013505 12.0 0.8084
AT3G28345 MDR13, ABCB15 multi-drug resistance 13, ATP-... Lus10034967 13.4 0.8071
AT1G61420 S-locus lectin protein kinase ... Lus10019600 14.5 0.7821
AT1G50420 GRAS SCL-3, SCL3 scarecrow-like 3 (.1) Lus10016892 16.7 0.7982

Lus10031707 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.