Plant FIBer expression Database

Lus10031710 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51545 118 / 9e-34 LPA2 low psii accumulation2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031131
[exp]
239 / 2e-81 AT5G51545 146 / 1e-44 low psii accumulation2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G129600
[exp]
120 / 1e-34 AT5G51545 118 / 1e-33 low psii accumulation2 (.1)
Potri.012G128000
[exp]
66 / 2e-13 AT5G51545 59 / 7e-11 low psii accumulation2 (.1)
PFAM info
Representative CDS sequence
>Lus10031710 pacid=23180686 polypeptide=Lus10031710 locus=Lus10031710.g ID=Lus10031710.BGIv1.0 annot-version=v1.0
ATGGCGCTACAATTCCACTCACCAGTTCCTCTCACTGACCAACCTTATCGTCATCATCCCAACCTCCACCTCCAAATCTCTTCCCGGAAGCTCAAATTCT
CCGTCAGATCGCAAAATCCGTCGACGGAATCTGCTAACGAACCTGCTCCTCCGCCCAAGAAAGGCTTCGGGTCGTCGTCGCCTCCCGCTAAGCCCGCCGG
AAGCGGTAAGAAGAAGCAGAAGGGGAGAAGAGAGAGGGAGGATATAATCAGGCGGTCTCCGGTGGGGAAGCAGGCGTTTATCGGCGAGAAAGTTGAAGGA
AAGGCCGACGAGGAGCAAGGGGCGAACGAGCGTGCTTTTGTTCTCACTTGGTTAGGGCTTGGAGGAGTCATTCTGGTTCAAGGAATCGTCCTTTCAGCTT
CAGGGTTCCTACCAGAAGAATGGGATAGGTTCTTTGTAAAGTATCTATTTCCAACTTTCACTCCAACGGTTGGTTTGTTTCTTGCTGGGACTGTGGCGTA
TGGAGTGTTGAAGTATCTACAGAATGAGAAGCTTAAAGAGAAGAAGTGA
AA sequence
>Lus10031710 pacid=23180686 polypeptide=Lus10031710 locus=Lus10031710.g ID=Lus10031710.BGIv1.0 annot-version=v1.0
MALQFHSPVPLTDQPYRHHPNLHLQISSRKLKFSVRSQNPSTESANEPAPPPKKGFGSSSPPAKPAGSGKKKQKGRREREDIIRRSPVGKQAFIGEKVEG
KADEEQGANERAFVLTWLGLGGVILVQGIVLSASGFLPEEWDRFFVKYLFPTFTPTVGLFLAGTVAYGVLKYLQNEKLKEKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51545 LPA2 low psii accumulation2 (.1) Lus10031710
[exp]
0 1
AT1G56180 unknown protein Lus10006532
[exp]
1.0 0.9479
AT3G25480 Rhodanese/Cell cycle control p... Lus10005853
[exp]
3.5 0.9346
AT5G51545 LPA2 low psii accumulation2 (.1) Lus10031131
[exp]
3.7 0.9130
AT3G10230 AtLCY, LYC lycopene cyclase (.1.2) Lus10027278
[exp]
6.6 0.9180
AT4G02530 chloroplast thylakoid lumen pr... Lus10030109
[exp]
9.3 0.9182
AT5G11580 Regulator of chromosome conden... Lus10038724
[exp]
10.2 0.9041
AT1G32550 FdC1 ferredoxin C 1, 2Fe-2S ferredo... Lus10004576
[exp]
12.5 0.9142
AT5G46420 16S rRNA processing protein Ri... Lus10004590
[exp]
13.6 0.9129
AT1G54780 AtTLP18.3, TLP1... thylakoid lumen protein 18.3, ... Lus10029979
[exp]
13.6 0.9154
AT1G69935 SHW1 short hypocotyl in white light... Lus10030808
[exp]
14.8 0.8794

Lus10031710 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.