Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62360 145 / 8e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 142 / 2e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 133 / 4e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 132 / 9e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 130 / 1e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 129 / 2e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 129 / 2e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G51520 127 / 8e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 125 / 6e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 124 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031132 [exp] 384 / 2e-138 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 150 / 4e-46 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 150 / 7e-46 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 147 / 9e-45 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 144 / 2e-43 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 143 / 4e-43 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 143 / 7e-43 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027199 [exp] 140 / 9e-42 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10028910 [exp] 135 / 7e-40 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G128400 [exp] 196 / 8e-64 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 151 / 2e-46 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 151 / 3e-46 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 147 / 1e-44 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 140 / 6e-42 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 139 / 1e-41 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.012G127500 [exp] 139 / 1e-41 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 138 / 3e-41 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G109300 [exp] 134 / 1e-39 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113600 [exp] 134 / 2e-39 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10031711 pacid=23180753 polypeptide=Lus10031711 locus=Lus10031711.g ID=Lus10031711.BGIv1.0 annot-version=v1.0 ATGGCTGGCTTTCCCTTTCTACCTATAGTGTTACTATCCCTCCTCTTCTCCACGGCCGTCGGATCAGGAAGCCACCAACACCATCGTCCGAATCCAACGG CCACAACCCACTACGACTTCATCAAGTCATCCTGCGGGGTCACAAGGTACCCAGACCTCTGCTACTCCACGCTATCGCCCTACGCCGCCACCGTACGGAG CAACTCAACTCAGCTGGTGAACGCTGCAATCCAGGTAAGTCTGAACGACGCCGTGTCGGCTTGCAACGCAGTGCAGAACCTCTCGAAGACTTTGAAGCAG CCCAAGGAGGCGGGAGCGGTTAAGGACTGCGTGGAGAACATGAAGGATTCGGTGGACGAGCTGAAGGATTCGATGGCTGCGATGAAGAGCGGGATGGACG GTCCGGATTTCGCCATGGAGGTCGGGAACCTGCAGACGTGGGTGAGCGCTGCGCTGACGGATGAGGACACGTGTATGGACGGGATTGAGGAAGCCGAGCT GGTGAACGGGAAGGTTAAGGATGCGATACGGGGTCGTATTGTGAGGGTTGCTCAGCTTACTAGTAATGCTCTTGCCCTTATTAATCATCTTTGTTAA
AA sequence Show only first row Show all	>Lus10031711 pacid=23180753 polypeptide=Lus10031711 locus=Lus10031711.g ID=Lus10031711.BGIv1.0 annot-version=v1.0 MAGFPFLPIVLLSLLFSTAVGSGSHQHHRPNPTATTHYDFIKSSCGVTRYPDLCYSTLSPYAATVRSNSTQLVNAAIQVSLNDAVSACNAVQNLSKTLKQ PKEAGAVKDCVENMKDSVDELKDSMAAMKSGMDGPDFAMEVGNLQTWVSAALTDEDTCMDGIEEAELVNGKVKDAIRGRIVRVAQLTSNALALINHLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62360			Plant invertase/pectin methyle...		Lus10031711 [exp]	0	1
AT5G41070		DRB5	dsRNA-binding protein 5 (.1)		Lus10035176 [exp]	3.3	0.9099
AT2G27385			Pollen Ole e 1 allergen and ex...		Lus10020642 [exp]	5.7	0.8900
					Lus10035486 [exp]	6.0	0.8662
AT5G54630	C2H2ZnF		zinc finger protein-related (....		Lus10043080 [exp]	7.3	0.8678
					Lus10002011 [exp]	11.0	0.8633
AT1G17140		RIP1, ICR1	ROP INTERACTIVE PARTNER 1, int...		Lus10005576 [exp]	11.8	0.8501
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10041893 [exp]	12.0	0.8624
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10011473 [exp]	14.2	0.8524
AT1G16070	TUB	AtTLP8	tubby like protein 8 (.1.2)		Lus10024102 [exp]	15.9	0.7011
AT4G35190		LOG5	LONELY GUY 5, Putative lysine ...		Lus10022638 [exp]	19.0	0.8361

Compare expression of checked genes

Lus10031711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.