Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51520 129 / 2e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 124 / 1e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 111 / 9e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 106 / 7e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 106 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 104 / 5e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 102 / 8e-27 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 100 / 1e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 99 / 1e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 97 / 4e-25 PME1 pectin methylesterase inhibitor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027198 [exp] 120 / 2e-34 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 120 / 3e-34 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 106 / 8e-29 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 104 / 6e-28 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 103 / 2e-27 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10028910 [exp] 102 / 4e-27 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 100 / 2e-26 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10004327 [exp] 99 / 2e-25 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038645 [exp] 97 / 7e-25 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G127400 [exp] 149 / 1e-45 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128500 [exp] 143 / 4e-43 AT4G25250 144 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128900 [exp] 135 / 4e-40 AT4G25250 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 118 / 2e-33 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 117 / 4e-33 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 111 / 1e-30 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G132600 [exp] 110 / 4e-30 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 108 / 1e-29 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 107 / 3e-29 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G109300 [exp] 103 / 2e-27 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10031712 pacid=23180585 polypeptide=Lus10031712 locus=Lus10031712.g ID=Lus10031712.BGIv1.0 annot-version=v1.0 ATGAATCCATCAACTCTCCTCTTCACCATTTCCTTCCTCTTCCTATCAACCGCCGCCGCCTCCACCACCACCACCGCCAGTACCAAAAATTACAAAACCT ACTTAAAATCCGCATGCTCATCCGCCACGTACCCACAAGTATGCTACACCTCACTCTCCCCATACGCCTCAAAGATCAAGACCAACGACGTCAACCTCAT CGCCTCCGCCATCTCCGTCAGCCTTAAGGCGGCGCGTGAAACCAACGCGCTTGTCTCCCGCCTCCGCAAGAGCAAGTCGCTGGGGGCAGACGGCGCCGCG GTGCTCAAAGACTGCGCCGAGGAGATCAAGGACACGATCGACGAGCTGCGGCAGTCGAACAACGCGCTGAGCGAGGTGAAGAGGAAGAGGCGCGCGGCGC AGGCCGAGGACGCGTCGCTGGAACTGGCGAATATGAGGACGTGGCTGAGCGCGGCGATCACGGACGAGACCACGTGTACCGACGGGTTCGACGGCGCGTA CGTGAGTGCGGCGGTGAAGGAGAAGGTGTGGAAGAGTGTTAAGAAGGTTGGGACGTATACTAGTAATGCTTTGGCTCTCGTTGACAAGCTTAGCTATTGA
AA sequence Show only first row Show all	>Lus10031712 pacid=23180585 polypeptide=Lus10031712 locus=Lus10031712.g ID=Lus10031712.BGIv1.0 annot-version=v1.0 MNPSTLLFTISFLFLSTAAASTTTTASTKNYKTYLKSACSSATYPQVCYTSLSPYASKIKTNDVNLIASAISVSLKAARETNALVSRLRKSKSLGADGAA VLKDCAEEIKDTIDELRQSNNALSEVKRKRRAAQAEDASLELANMRTWLSAAITDETTCTDGFDGAYVSAAVKEKVWKSVKKVGTYTSNALALVDKLSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51520			Plant invertase/pectin methyle...		Lus10031712 [exp]	0	1
AT1G75240	ZF_HD	ATHB33, ZHD5	zinc-finger homeodomain 5, hom...		Lus10031315 [exp]	1.0	0.9632
AT5G66440			unknown protein		Lus10041775 [exp]	1.7	0.9557
AT1G05010		ACO4, EAT1, EFE	ethylene forming enzyme, ethyl...		Lus10015153 [exp]	2.2	0.9508
AT4G34810			SAUR-like auxin-responsive pro...		Lus10026294 [exp]	4.0	0.9448
AT1G20190		ATHEXPALPHA1.14...	EXPANSIN 11, expansin 11 (.1)		Lus10021845 [exp]	4.2	0.9602
AT2G26700		PID2	PINOID2, AGC (cAMP-dependent, ...		Lus10013715 [exp]	4.6	0.9471
AT5G11420			Protein of unknown function, D...		Lus10035910 [exp]	5.3	0.9549
AT1G19440		KCS4	3-ketoacyl-CoA synthase 4 (.1)		Lus10042318 [exp]	7.3	0.9304
AT1G75240	ZF_HD	ATHB33, ZHD5	zinc-finger homeodomain 5, hom...		Lus10031885 [exp]	7.7	0.9362
AT1G20870			HSP20-like chaperones superfam...		Lus10013203 [exp]	7.9	0.8761

Compare expression of checked genes

Lus10031712 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.