Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62350 201 / 5e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 194 / 3e-63 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 185 / 1e-59 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 161 / 5e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 159 / 3e-49 PME1 pectin methylesterase inhibitor 1 (.1) AT5G62360 150 / 9e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 137 / 1e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 132 / 2e-38 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 130 / 3e-38 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031133 [exp] 372 / 1e-133 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 217 / 2e-72 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 216 / 7e-72 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 149 / 4e-45 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 147 / 9e-45 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 147 / 1e-44 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027199 [exp] 142 / 1e-42 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 135 / 4e-40 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 133 / 6e-39 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G128700 [exp] 233 / 1e-78 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 233 / 2e-78 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 178 / 8e-57 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128100 [exp] 174 / 5e-55 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 172 / 1e-54 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 165 / 7e-52 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128400 [exp] 149 / 3e-45 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 144 / 2e-43 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G137800 [exp] 141 / 3e-42 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G145800 [exp] 140 / 5e-42 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10031713 pacid=23180788 polypeptide=Lus10031713 locus=Lus10031713.g ID=Lus10031713.BGIv1.0 annot-version=v1.0 ATGGCAAACCCCACATTTCCCCTTCTTCTAATCTCTGTCCTCACCATCACCCTAGCTTCAGCATCCAACCCGGCGACGACATCGAGCATCGTCGCAGCGA CAAACTTCATAAAGTCCTCCTGCAGGACCACAACCTACCCAGCACTGTGCGTGCAGTCGCTCCTGTCCTACGCCCCGACCATCCAGCGCAGTCCGCGTCA GTTGGCGCAGACTGCACTGGCAGTGAGCCTGATCAGAGCGCAGTCCGCCAGCTCCTACGTCAGGAAGCTGGCGAGGTTCAAGGGTCTGAGGCCCAAGGAG GCGGCCGCCATCAAAGACTGCAAGGAGGAGATCGAGGACACCGTCGACCGGCTGAGCAAGTCGATCAAGGAGCTGAAGATGGTCAGGACGGGTGGCGGGC CGGGGTTCGAGTGGCACGTGAGCAACGTGGTGACGTGGGTCAGCGCGGCGCTGACTAACGAGAACACGTGTGTGGACGGGTTCGGTGGGAAGGCGTTGAA TGGGAGGATGAAGGATGGGATTAGAGGGAGGTTTAGGAACACTGTTCAGGTTACTAGTAATGCTTTGGCTTTGATTAATAAGTATGCTAAGCACTGA
AA sequence Show only first row Show all	>Lus10031713 pacid=23180788 polypeptide=Lus10031713 locus=Lus10031713.g ID=Lus10031713.BGIv1.0 annot-version=v1.0 MANPTFPLLLISVLTITLASASNPATTSSIVAATNFIKSSCRTTTYPALCVQSLLSYAPTIQRSPRQLAQTALAVSLIRAQSASSYVRKLARFKGLRPKE AAAIKDCKEEIEDTVDRLSKSIKELKMVRTGGGPGFEWHVSNVVTWVSAALTNENTCVDGFGGKALNGRMKDGIRGRFRNTVQVTSNALALINKYAKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62350			Plant invertase/pectin methyle...		Lus10031713 [exp]	0	1
AT2G32830		PHT1;5, PHT5	PHOSPHATE TRANSPORTER 5, phosp...		Lus10022547 [exp]	1.7	0.8755
AT3G45230			hydroxyproline-rich glycoprote...		Lus10021479 [exp]	6.9	0.8506
AT1G10340			Ankyrin repeat family protein ...		Lus10038608 [exp]	6.9	0.8519
AT2G41810			Protein of unknown function, D...		Lus10035451 [exp]	7.3	0.7992
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10015286 [exp]	13.3	0.8124
AT1G24140			Matrixin family protein (.1)		Lus10035221 [exp]	14.3	0.8038
AT5G10760			Eukaryotic aspartyl protease f...		Lus10026905 [exp]	18.1	0.7917
AT1G33760	AP2_ERF		Integrase-type DNA-binding sup...		Lus10041052 [exp]	19.4	0.7874
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10010864 [exp]	20.8	0.7903
AT1G10340			Ankyrin repeat family protein ...		Lus10038609 [exp]	21.0	0.7859

Compare expression of checked genes

Lus10031713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.