Lus10031717 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62360 140 / 7e-42 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 108 / 2e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 109 / 7e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 105 / 3e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 102 / 7e-27 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 99 / 2e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 94 / 1e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 94 / 1e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 87 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 86 / 1e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031138 258 / 6e-88 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 152 / 3e-46 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 150 / 9e-46 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 118 / 3e-33 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 113 / 2e-31 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 113 / 4e-31 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 112 / 6e-31 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 110 / 6e-30 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 104 / 1e-27 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G128200 157 / 2e-48 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 157 / 2e-48 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 150 / 7e-46 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 120 / 6e-34 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 117 / 4e-33 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 108 / 2e-29 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 108 / 3e-29 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 106 / 1e-28 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.010G109300 104 / 1e-27 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 99 / 1e-25 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10031717 pacid=23180803 polypeptide=Lus10031717 locus=Lus10031717.g ID=Lus10031717.BGIv1.0 annot-version=v1.0
ATGTCGGCGCCGGCATCATCCTCCGCCTACGTTCTCCTCGCCGTCACTTTCTTACTAGCCTCCACGTCATCAGCCTCCAGACCCATTTCCTCCTCCGCCT
CCGCCGGCGCCACAAACACAGAGTTCATCCGTACGTCATGCACCGCCACGTCATACCCGAAACTATGCTACACCTCCCTATCAACCCACGCCACCAAGAT
CCAGACCAGCCCCAAGCTCCTGGCCTCCGCCGCCCTCCACGTGGCCCTGTCATCGGCCAAGTCAGCCTCGGCTGAGATGGCCGAGATCTCCCGCGGCCAT
CTTCACGGCCCCCGCGAGGTGGGGGCCATGCAGGACTGCGTGGAGGAGCTTGAAGACTCTGTTGACCAAATTCACGAATCGGTCAACAGAATGGAGGGCA
AGGAAACAGACAATAATACTAAGAACAAGGGTGCGGATTTCGAGAGGATGATTAACGACGTGGAGACTTGGGTCAGCGCGGCGTTGACCGACCAAGGCAC
GTGCAGCGACGGGTTCGGAGAGATGGACGGAGAGTTGAGGAAGGTTGTGAAAGGGAAGGTTGTGAAAGTGGCTAAGCTTACTAGTAATGCTTTGGATCTG
ATTAGCAACTATGCTTCTCTACATTGA
AA sequence
>Lus10031717 pacid=23180803 polypeptide=Lus10031717 locus=Lus10031717.g ID=Lus10031717.BGIv1.0 annot-version=v1.0
MSAPASSSAYVLLAVTFLLASTSSASRPISSSASAGATNTEFIRTSCTATSYPKLCYTSLSTHATKIQTSPKLLASAALHVALSSAKSASAEMAEISRGH
LHGPREVGAMQDCVEELEDSVDQIHESVNRMEGKETDNNTKNKGADFERMINDVETWVSAALTDQGTCSDGFGEMDGELRKVVKGKVVKVAKLTSNALDL
ISNYASLH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62360 Plant invertase/pectin methyle... Lus10031717 0 1
AT5G15310 MYB ATMYB16, ATMIXT... myb domain protein 16 (.1.2) Lus10033003 1.4 0.9227
AT5G14510 ARM repeat superfamily protein... Lus10022275 2.4 0.9194
AT4G38840 SAUR-like auxin-responsive pro... Lus10008996 4.9 0.9067
AT4G34530 bHLH bHLH063, CIB1 cryptochrome-interacting basic... Lus10040448 5.7 0.8644
AT5G13460 IQD11 IQ-domain 11 (.1) Lus10005315 5.9 0.8833
AT3G29030 ATEXP5, ATHEXPA... ARABIDOPSIS THALIANA EXPANSIN ... Lus10033011 6.0 0.8770
AT1G26260 bHLH CIB5, bHLH076 cryptochrome-interacting basic... Lus10023562 6.0 0.8669
AT4G38840 SAUR-like auxin-responsive pro... Lus10009000 6.0 0.8862
AT2G02800 Kin2, APK2B protein kinase 2B (.1.2) Lus10042192 6.3 0.8644
AT4G38840 SAUR-like auxin-responsive pro... Lus10009627 7.0 0.8683

Lus10031717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.