Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47420 125 / 6e-35 AtG3Pp1, ATPS3 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) AT4G25220 112 / 2e-30 AtG3Pp2, RHS15 glycerol-3-phosphate permease 2, root hair specific 15 (.1) AT4G17550 111 / 6e-30 AtG3Pp4 glycerol-3-phosphate permease 4, Major facilitator superfamily protein (.1) AT1G30560 110 / 1e-29 AtG3Pp3 glycerol-3-phosphate permease 3, Major facilitator superfamily protein (.1) AT2G13100 100 / 2e-26 AtG3Pp5 glycerol-3-phosphate permease 5, Major facilitator superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031153 [exp] 164 / 9e-50 AT3G47420 695 / 0.0 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) Lus10027211 [exp] 139 / 1e-41 AT3G47420 454 / 9e-159 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) Lus10038923 [exp] 139 / 1e-40 AT3G47420 586 / 0.0 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) Lus10027210 [exp] 133 / 8e-38 AT3G47420 705 / 0.0 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) Lus10040154 [exp] 116 / 1e-31 AT4G17550 734 / 0.0 glycerol-3-phosphate permease 4, Major facilitator superfamily protein (.1) Lus10004358 [exp] 115 / 3e-31 AT4G17550 725 / 0.0 glycerol-3-phosphate permease 4, Major facilitator superfamily protein (.1) Lus10040002 [exp] 96 / 3e-24 AT2G13100 708 / 0.0 glycerol-3-phosphate permease 5, Major facilitator superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G109300 [exp] 138 / 8e-40 AT3G47420 694 / 0.0 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) Potri.001G124200 [exp] 138 / 1e-39 AT3G47420 711 / 0.0 Glycerol-3-phosphate permease 1, phosphate starvation-induced gene 3 (.1) Potri.001G152300 [exp] 112 / 4e-30 AT4G17550 692 / 0.0 glycerol-3-phosphate permease 4, Major facilitator superfamily protein (.1) Potri.003G082366 [exp] 109 / 4e-29 AT4G17550 624 / 0.0 glycerol-3-phosphate permease 4, Major facilitator superfamily protein (.1) Potri.018G115000 [exp] 99 / 2e-25 AT2G13100 699 / 0.0 glycerol-3-phosphate permease 5, Major facilitator superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031729 pacid=23180658 polypeptide=Lus10031729 locus=Lus10031729.g ID=Lus10031729.BGIv1.0 annot-version=v1.0 ATGTTGCTGACAGGAGTGTTCGTCAACGGTCCATACGCGCTCATAACGACTGCGGTATCAGCCGATCTGGACATGCACAGCTCGTTGAGAGGCAACTCGA GGGCGTTGGCTACGGTCACAGCCATAATCGACGGGACCGGTTCAGTTGGGGCAGCGATCGGACCGTTGCTGACCGGGTATATATCAGCTAGTAGTTGGGG TCCGGTTTTTGTCATGTTGATGGTTGCCGCCTTTGTGGCCGGGTTGCTATTGACTAGGCTTGTTGTTGCCGAGGTTGGTGCTAAGATTGTCGAGTCCAGG TGCGAGGCAAGTTCGTCGATTGATGTTGATGTTTGA
AA sequence Show only first row Show all	>Lus10031729 pacid=23180658 polypeptide=Lus10031729 locus=Lus10031729.g ID=Lus10031729.BGIv1.0 annot-version=v1.0 MLLTGVFVNGPYALITTAVSADLDMHSSLRGNSRALATVTAIIDGTGSVGAAIGPLLTGYISASSWGPVFVMLMVAAFVAGLLLTRLVVAEVGAKIVESR CEASSSIDVDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47420		AtG3Pp1, ATPS3	Glycerol-3-phosphate permease ...		Lus10031729 [exp]	0	1
					Lus10037674 [exp]	7.2	0.7238
AT1G45249	bZIP	AtABF2, ATAREB1...	ABSCISIC ACID RESPONSIVE ELEME...		Lus10009755 [exp]	12.5	0.7491
AT2G32280			Protein of unknown function (D...		Lus10038567 [exp]	27.3	0.6644
AT1G02810			Plant invertase/pectin methyle...		Lus10029866 [exp]	144.5	0.6309
AT2G22260			oxidoreductase, 2OG-Fe(II) oxy...		Lus10039112 [exp]	210.5	0.6070
AT4G10120		ATSPS4F	Sucrose-phosphate synthase fam...		Lus10006183 [exp]	212.5	0.6058
AT3G24730			mRNA splicing factor, thioredo...		Lus10022811 [exp]	221.8	0.6100
					Lus10026245 [exp]	256.8	0.6014

Compare expression of checked genes

Lus10031729 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.