Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23220 101 / 4e-29 Dynein light chain type 1 family protein (.1) AT5G20110 100 / 1e-27 Dynein light chain type 1 family protein (.1) AT4G27360 68 / 4e-16 Dynein light chain type 1 family protein (.1) AT4G15930 65 / 1e-14 Dynein light chain type 1 family protein (.1) AT1G52240 60 / 4e-13 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 58 / 2e-12 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021793 [exp] 109 / 4e-32 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 107 / 4e-31 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10004252 [exp] 84 / 4e-20 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1) Lus10014484 [exp] 80 / 1e-19 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 79 / 2e-19 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10025794 [exp] 63 / 3e-14 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 61 / 1e-13 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 61 / 2e-13 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 61 / 2e-13 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124700 [exp] 129 / 1e-39 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 117 / 5e-35 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 117 / 9e-35 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 113 / 2e-33 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 111 / 6e-33 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 110 / 7e-33 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 96 / 3e-25 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 67 / 7e-16 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 65 / 3e-15 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 66 / 4e-15 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10031734 pacid=23180717 polypeptide=Lus10031734 locus=Lus10031734.g ID=Lus10031734.BGIv1.0 annot-version=v1.0 ATGCAGGAGCGCGCCTTCCGTTGTACCAGAGCCTTCCTCGACGCTTCCCCTGACAGGAAACGCATCAACCCATCTCGTCTCGCCATGGCCTTGAAGAAGG AGTTTGACGGTGCTTATGGACCGGCGTGGCATTGCATAGCGGGGAAGAGCTTCGGGTCGTTCGTGACGCACGCCAATGGCGGGTTCGTGTACTTCTCAGT GGACGAGACGCTCTGTCTGCTTCTGTTCAAGACGGAGGTACGGCCGGTGGTGAACTCGAAACCGCCGTCGCTGATGAAACTCGACATCAAGTAG
AA sequence Show only first row Show all	>Lus10031734 pacid=23180717 polypeptide=Lus10031734 locus=Lus10031734.g ID=Lus10031734.BGIv1.0 annot-version=v1.0 MQERAFRCTRAFLDASPDRKRINPSRLAMALKKEFDGAYGPAWHCIAGKSFGSFVTHANGGFVYFSVDETLCLLLFKTEVRPVVNSKPPSLMKLDIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23220			Dynein light chain type 1 fami...		Lus10031734 [exp]	0	1
AT1G25580	NAC	ANAC008, SOG1	SUPPRESSOR OF GAMMA RADIATION ...		Lus10021708 [exp]	1.7	0.8389
AT3G50620			P-loop containing nucleoside t...		Lus10002971 [exp]	4.9	0.8249
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10041743 [exp]	8.2	0.8377
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Lus10006234 [exp]	10.2	0.8044
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10030317 [exp]	11.1	0.7402
AT4G33100			unknown protein		Lus10014752 [exp]	12.4	0.8105
AT3G51060		SRS1, STY1	STYLISH 1, SHI RELATED SEQUENC...		Lus10041803 [exp]	12.8	0.7993
AT1G74240			Mitochondrial substrate carrie...		Lus10017849 [exp]	19.4	0.7819
					Lus10012330 [exp]	21.9	0.8018
AT1G56140			Leucine-rich repeat transmembr...		Lus10020688 [exp]	22.2	0.8041

Compare expression of checked genes

Lus10031734 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.