Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47440 190 / 2e-61 TIP5;1 tonoplast intrinsic protein 5;1 (.1) AT3G16240 125 / 7e-36 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT4G17340 124 / 2e-35 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT5G47450 117 / 6e-33 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT2G25810 108 / 1e-29 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT1G73190 107 / 4e-29 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT1G17810 107 / 5e-29 BETA-TIP beta-tonoplast intrinsic protein (.1) AT4G01470 106 / 8e-29 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT2G36830 103 / 1e-27 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT3G26520 103 / 2e-27 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031158 [exp] 188 / 3e-62 AT3G47440 155 / 2e-48 tonoplast intrinsic protein 5;1 (.1) Lus10004733 [exp] 123 / 3e-35 AT5G47450 393 / 4e-140 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10007796 [exp] 122 / 5e-35 AT5G47450 389 / 1e-138 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10038293 [exp] 119 / 2e-33 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10025808 [exp] 112 / 5e-31 AT3G16240 389 / 2e-138 delta tonoplast integral protein (.1) Lus10037895 [exp] 109 / 7e-30 AT2G25810 371 / 2e-131 tonoplast intrinsic protein 4;1 (.1) Lus10040652 [exp] 108 / 2e-29 AT1G17810 367 / 2e-129 beta-tonoplast intrinsic protein (.1) Lus10018256 [exp] 105 / 3e-28 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1) Lus10003288 [exp] 104 / 7e-28 AT4G01470 388 / 6e-138 tonoplast intrinsic protein 1;3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124800 [exp] 230 / 6e-77 AT3G47440 317 / 7e-110 tonoplast intrinsic protein 5;1 (.1) Potri.003G108500 [exp] 222 / 6e-74 AT3G47440 320 / 5e-111 tonoplast intrinsic protein 5;1 (.1) Potri.003G077800 [exp] 125 / 5e-36 AT4G17340 351 / 2e-123 tonoplast intrinsic protein 2;2 (.1) Potri.003G050900 [exp] 119 / 1e-33 AT3G16240 311 / 5e-108 delta tonoplast integral protein (.1) Potri.001G186700 [exp] 118 / 2e-33 AT3G16240 372 / 8e-132 delta tonoplast integral protein (.1) Potri.001G157000 [exp] 113 / 3e-31 AT4G17340 333 / 3e-116 tonoplast intrinsic protein 2;2 (.1) Potri.010G209900 [exp] 109 / 8e-30 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.018G152100 [exp] 108 / 2e-29 AT1G17810 350 / 8e-123 beta-tonoplast intrinsic protein (.1) Potri.008G050700 [exp] 107 / 3e-29 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.017G154800 [exp] 106 / 1e-28 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10031735 pacid=23180815 polypeptide=Lus10031735 locus=Lus10031735.g ID=Lus10031735.BGIv1.0 annot-version=v1.0 ATGGCTGTCGGAGGCCACGTCAGCGTCCCGACGGCTCTGTTCTACTGGCTTTCTCAGATGTTGGCCTCTGTTTTTGCTTCTCTGCTTATCCGAGTCATGA CCGTTTCCCAACATGTACCAGCCTACACGATTGCGGACGAAATGACGGGATTCGGGGCATCGATGCTGGAAGGTCTTCTAACATTTGTGTTGGTGTACAC GGTCTATGCATGTAACGATGCCAGATGTGGACCGTTGACCGCGATCGGGCCGCTGGTTATAGGGCTAACTGCTGGAGCGGGAGTGTTGACGGCTGGGCCG TTCTCGGGCGGGGCGATGAACCCGGCTTGTGCTTTTGGGTCCGCGGTTATTGCTGGGAAGTTTAGTAACCAGGCGGTTTACTGGGTTGGACCGTTGATTG GGGCGGCGGTTGCGGGTTTGGTTTATGATAACGTTGTGTATCCTCCGGCTGAGGCGAGTGATTCGATTAGAGGGGTTGCTGAAGGCGTAGAAGTTTGA
AA sequence Show only first row Show all	>Lus10031735 pacid=23180815 polypeptide=Lus10031735 locus=Lus10031735.g ID=Lus10031735.BGIv1.0 annot-version=v1.0 MAVGGHVSVPTALFYWLSQMLASVFASLLIRVMTVSQHVPAYTIADEMTGFGASMLEGLLTFVLVYTVYACNDARCGPLTAIGPLVIGLTAGAGVLTAGP FSGGAMNPACAFGSAVIAGKFSNQAVYWVGPLIGAAVAGLVYDNVVYPPAEASDSIRGVAEGVEV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031735 [exp]	0	1
AT3G23130	C2H2ZnF	FLO10, FON1, SU...	SUPERMAN, FLORAL ORGAN NUMBER ...		Lus10022206 [exp]	1.0	0.7988
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10002934 [exp]	4.9	0.7735
AT5G48540			receptor-like protein kinase-r...		Lus10006752 [exp]	15.1	0.7159
AT5G62480		GST14B, ATGSTU9	GLUTATHIONE S-TRANSFERASE 14B,...		Lus10023595 [exp]	18.6	0.6902
AT2G46570		LAC6	laccase 6 (.1)		Lus10030235 [exp]	22.8	0.7104
AT2G40410			Staphylococcal nuclease homolo...		Lus10041146 [exp]	23.2	0.6994
AT4G25400	bHLH	bHLH118	basic helix-loop-helix (bHLH) ...		Lus10027396 [exp]	24.1	0.7049
AT4G18220			Drug/metabolite transporter su...		Lus10028132 [exp]	25.9	0.6791
					Lus10028051 [exp]	27.8	0.7159
AT4G27410	NAC	RD26, ANAC072	NAC (No Apical Meristem) domai...		Lus10003458 [exp]	31.5	0.6590

Compare expression of checked genes

Lus10031735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.