Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013647 [exp] 52 / 4e-09 AT5G04885 508 / 2e-175 Glycosyl hydrolase family protein (.1) Lus10024254 [exp] 42 / 1e-05 ND / Lus10035498 [exp] 41 / 3e-05 AT3G02850 206 / 2e-61 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031737 pacid=23180701 polypeptide=Lus10031737 locus=Lus10031737.g ID=Lus10031737.BGIv1.0 annot-version=v1.0 ATGGACCTCACGGAGGAAATCATCATGGCGGACGTGGAAGTCGACGGCGGGCACTTTGATGCCGGCGGCGAAAGAGACCAGCTGAATTTCACATTTACTC GATGTATTTTTGCCAAGAAGATGAACTTAGGATTGGAATTTTTGCTTCATTCCCTTCGCGAGATGACGATGATGTCGCCAGAACGAGGAAAGGACGCGAT GCAGCTGGACAAAGAACAACCAATGGTGACATTTGAGGGTATTCGGGAACACCCAAAAAACTTGGCAATGACAGGTCTCTCTAGGTCCTGCCACACGGCT TAA
AA sequence Show only first row Show all	>Lus10031737 pacid=23180701 polypeptide=Lus10031737 locus=Lus10031737.g ID=Lus10031737.BGIv1.0 annot-version=v1.0 MDLTEEIIMADVEVDGGHFDAGGERDQLNFTFTRCIFAKKMNLGLEFLLHSLREMTMMSPERGKDAMQLDKEQPMVTFEGIREHPKNLAMTGLSRSCHTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10031737 [exp]	0	1
AT4G31050			Biotin/lipoate A/B protein lig...		Lus10008181 [exp]	1.0	0.9188
					Lus10026869 [exp]	2.0	0.8687
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10042522 [exp]	2.0	0.8083
AT5G64700			nodulin MtN21 /EamA-like trans...		Lus10020867 [exp]	3.0	0.8142
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10031478 [exp]	4.5	0.8007
					Lus10039495 [exp]	10.6	0.7328
					Lus10008920 [exp]	11.2	0.7817
AT5G52300		LTI65, RD29B	RESPONSIVE TO DESSICATION 29B,...		Lus10038862 [exp]	11.7	0.5893
AT4G16480		ATINT4	inositol transporter 4 (.1)		Lus10010501 [exp]	13.3	0.7102
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Lus10030442 [exp]	15.8	0.6867

Compare expression of checked genes

Lus10031737 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.