Lus10031751 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16445 86 / 1e-20 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031174 249 / 1e-84 AT1G16445 311 / 8e-107 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G069400 108 / 3e-29 AT1G16445 311 / 5e-107 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10031751 pacid=23180723 polypeptide=Lus10031751 locus=Lus10031751.g ID=Lus10031751.BGIv1.0 annot-version=v1.0
ATGGCGGGATTGAAGCTCAGCTACTGCTTCTCTCCTCATCGCCATTGGTTCACTTCACTACACAAAATCCTAACAACTACTATTCCATTCTGCGATTCTT
CCCGCCTTCATTACTCATCCGGCAAATATTCTCATTCTTGCCGAACAATACCAGCTGCCATTTCTGTGAAAAAGAACCGAACTTTCTCCTCTTCCGCCGC
CTATGATTCTCCTCTTTCGGGATTGGATGACATTTTGGTTGGGTACCTCTTGGGGAAGAATAAGACAACTGAAGTACATTTGGTGTGGAGTTGTGTAGTT
CAGCAAGGGGATACTGTGATTGATGCCACTTGTGGCAATGGTCATGACGCCTTAGCTATGGTCAAAATGGTTGCTGACAAATCGGGCAGAGGCCGTGTCT
ATGGACTCTACTGGTTTTCTTGTTCAAAAGATGATCATATCAAACATTCTTATCTGATTCTTAAAAGTCCAAACTGA
AA sequence
>Lus10031751 pacid=23180723 polypeptide=Lus10031751 locus=Lus10031751.g ID=Lus10031751.BGIv1.0 annot-version=v1.0
MAGLKLSYCFSPHRHWFTSLHKILTTTIPFCDSSRLHYSSGKYSHSCRTIPAAISVKKNRTFSSSAAYDSPLSGLDDILVGYLLGKNKTTEVHLVWSCVV
QQGDTVIDATCGNGHDALAMVKMVADKSGRGRVYGLYWFSCSKDDHIKHSYLILKSPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16445 S-adenosyl-L-methionine-depend... Lus10031751 0 1
AT5G50600 ATHSD1 hydroxysteroid dehydrogenase 1... Lus10031448 5.2 0.7690
Lus10017831 7.9 0.7583
Lus10008514 13.1 0.7032
AT2G33280 Major facilitator superfamily ... Lus10004407 15.5 0.6953
Lus10010102 17.3 0.7363
Lus10012394 22.7 0.6921
AT4G18470 SNI1 SUPPRESSOR OF NPR1-1, INDUCIBL... Lus10015299 36.2 0.5896
Lus10000289 48.1 0.5837
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Lus10011472 54.1 0.6365
AT1G75660 AtXRN3, XRN3 5'-3' exoribonuclease 3 (.1) Lus10005213 56.1 0.6084

Lus10031751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.