Lus10031754 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12830 154 / 4e-49 SAUR-like auxin-responsive protein family (.1)
AT1G56150 146 / 3e-46 SAUR-like auxin-responsive protein family (.1)
AT1G16510 129 / 6e-39 SAUR-like auxin-responsive protein family (.1)
AT1G79130 122 / 1e-36 SAUR-like auxin-responsive protein family (.1)
AT3G43120 66 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34770 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT3G61900 65 / 4e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34760 64 / 5e-14 SAUR-like auxin-responsive protein family (.1)
AT5G10990 65 / 6e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34800 63 / 9e-14 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018269 86 / 3e-21 AT1G16510 92 / 4e-24 SAUR-like auxin-responsive protein family (.1)
Lus10040643 81 / 7e-20 AT1G16510 91 / 8e-24 SAUR-like auxin-responsive protein family (.1)
Lus10012190 70 / 9e-16 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10034507 69 / 2e-15 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10035716 69 / 5e-15 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1)
Lus10042374 67 / 8e-15 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026297 67 / 9e-15 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10037302 69 / 2e-14 AT2G24400 150 / 2e-44 SAUR-like auxin-responsive protein family (.1)
Lus10012426 67 / 2e-14 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G067800 163 / 1e-52 AT3G12830 148 / 5e-47 SAUR-like auxin-responsive protein family (.1)
Potri.005G096400 159 / 5e-51 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 76 / 5e-18 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.010G253900 69 / 3e-15 AT3G20220 93 / 4e-25 SAUR-like auxin-responsive protein family (.1)
Potri.006G211000 67 / 5e-15 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.008G003900 66 / 1e-14 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 66 / 3e-14 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.001G060400 66 / 6e-14 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 66 / 6e-14 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
Potri.006G070600 65 / 6e-14 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10031754 pacid=23180625 polypeptide=Lus10031754 locus=Lus10031754.g ID=Lus10031754.BGIv1.0 annot-version=v1.0
ATGAAGCAGCTAATCCGCCGCCTCTCCCGCGTCGCCGACTCCTCCCAGTACTCCCTCCTACGCTCCGACTCCCGCTCCTGCCGCGCCGCCTCCGTCCGCC
GCGCCGAATCCTTCCGATCTTTGGTCAAATCCGCCAAGAGATCCAGCGGCGGGAAGTCCGTCCCGCAAGGATACGTCCCCGTCTACGTCGGCGACGAGAT
GGAGAGGTTCGTCGTCAGCGCCGAGCTCCTCAACCACCCCGTCTTCGTCGGTCTCCTCAACTGTTCCGCTCAGGAGTACGGCTACGAGCAGCAAGGCGGC
CTCCGGATCCCCTGCCACGTGTTGGCCTTCGAGCGGGTCATGGAGGCGATTCGCCTCGGTCTTCAGTCTCACGACCTCGACAACCTCCTCATCGCCGCCG
CCTCCGCCTCTTCTCCCTCTCCCTCTGTAGACGGCTACTTATGA
AA sequence
>Lus10031754 pacid=23180625 polypeptide=Lus10031754 locus=Lus10031754.g ID=Lus10031754.BGIv1.0 annot-version=v1.0
MKQLIRRLSRVADSSQYSLLRSDSRSCRAASVRRAESFRSLVKSAKRSSGGKSVPQGYVPVYVGDEMERFVVSAELLNHPVFVGLLNCSAQEYGYEQQGG
LRIPCHVLAFERVMEAIRLGLQSHDLDNLLIAAASASSPSPSVDGYL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12830 SAUR-like auxin-responsive pro... Lus10031754 0 1
AT1G56150 SAUR-like auxin-responsive pro... Lus10031178 5.1 0.7828
AT3G12620 Protein phosphatase 2C family ... Lus10030302 12.4 0.8145
AT1G34190 NAC ANAC017 NAC domain containing protein ... Lus10006054 21.0 0.8033
AT1G36980 unknown protein Lus10037355 22.9 0.8135
AT5G26600 Pyridoxal phosphate (PLP)-depe... Lus10001514 28.1 0.8070
AT4G02080 ASAR1, ATSARA1C... secretion-associated RAS super... Lus10010926 30.5 0.8094
AT4G14430 PEC12, IBR10, E... DELTA\(3\), DELTA\(2\)-ENOYL C... Lus10022199 32.2 0.7991
Lus10035642 33.2 0.8054
AT4G29010 AIM1 ABNORMAL INFLORESCENCE MERISTE... Lus10011102 38.6 0.7815
AT5G67250 VFB4, SKIP2 VIER F-BOX PROTEINE 4, SKP1/AS... Lus10011506 38.6 0.7675

Lus10031754 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.