Lus10031756 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06040 177 / 2e-56 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
AT1G70190 105 / 4e-28 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
AT4G37660 98 / 8e-26 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT4G36420 89 / 4e-22 Ribosomal protein L12 family protein (.1)
AT2G03130 62 / 1e-12 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G27850 59 / 5e-11 RPL12-C ribosomal protein L12-C (.1)
AT3G27830 59 / 7e-11 RPL12-A ribosomal protein L12-A (.1)
AT3G27840 50 / 1e-07 RPL12-B ribosomal protein L12-B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031180 318 / 2e-112 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10036228 105 / 3e-28 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10038367 105 / 4e-28 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10041783 99 / 4e-26 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1)
Lus10023839 98 / 1e-25 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10000093 98 / 1e-25 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10028336 97 / 2e-25 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1)
Lus10021011 95 / 2e-24 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10013078 64 / 8e-13 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G077200 236 / 9e-80 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Potri.003G074800 111 / 1e-30 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Potri.004G224300 101 / 5e-27 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Potri.007G019100 100 / 8e-27 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1)
Potri.001G346100 61 / 1e-11 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence
>Lus10031756 pacid=23180574 polypeptide=Lus10031756 locus=Lus10031756.g ID=Lus10031756.BGIv1.0 annot-version=v1.0
ATGAAGCTCGTTGCATTGGCAAGATCAGTCCGCTCCTCTCCGGAAGCCATCCGCGAGATCAATGGCTTCTTACAGGTCAGATTTTTTCAGCACGACTTCG
TTCCCAGAGACCCGTCGGCGAAACCGAAGAAGTACAAGTATCCCGAAATCTACAATCCGTACGGTCCAAGACCACCTCCATCGGAAAGAATCATTCAGCT
CGCCGAGCAAATCGCTGCTCTACCTCTCGACGAGCGGAAGCAAATCGGCCCTGCTCTCGGGTTGAAGCTTAGCCATCCGAAGCTGGAGACGATCTCTACG
GAAGGAATGGAGATGGGACCAGTTGGATCGGGAGGTGGATCGGCGGCTGGAAAGGCTGTGGAGGAGAAGAAGGAGAAGACTGCATTCGATGTTAAATTGG
AGAAGTTCGATGCAGCTGCGAAGATCAAAGTGATTAAAGAAGTCCGAGCTTTTACGAACTTGGGGTTGAAAGAAGCTAAGGAATTGGTTGAGAAAGCTCC
CGTTGTGCTTAAACAAGGAGTCACCAAAGACGAAGGGAACAGTGTCATTGAGAAGATTAAGGCCGCTGGTGGTGTCGCTGTCATGGAGTAA
AA sequence
>Lus10031756 pacid=23180574 polypeptide=Lus10031756 locus=Lus10031756.g ID=Lus10031756.BGIv1.0 annot-version=v1.0
MKLVALARSVRSSPEAIREINGFLQVRFFQHDFVPRDPSAKPKKYKYPEIYNPYGPRPPPSERIIQLAEQIAALPLDERKQIGPALGLKLSHPKLETIST
EGMEMGPVGSGGGSAAGKAVEEKKEKTAFDVKLEKFDAAAKIKVIKEVRAFTNLGLKEAKELVEKAPVVLKQGVTKDEGNSVIEKIKAAGGVAVME

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06040 Ribosomal protein L12/ ATP-dep... Lus10031756 0 1
AT4G23620 Ribosomal protein L25/Gln-tRNA... Lus10000590 3.2 0.9074
AT3G23990 HSP60-3B, HSP60 HEAT SHOCK PROTEIN 60-3B, heat... Lus10011902 9.9 0.8490
AT2G16600 ROC3 rotamase CYP 3 (.1.2) Lus10007579 10.7 0.8689
AT5G61030 GR-RBP3 glycine-rich RNA-binding prote... Lus10017852 13.0 0.8685
AT3G13160 Tetratricopeptide repeat (TPR)... Lus10007619 18.4 0.8808
AT1G23100 GroES-like family protein (.1) Lus10036055 20.6 0.8500
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10021027 21.0 0.8391
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10018588 21.2 0.8584
AT1G30580 GTP binding (.1) Lus10038543 21.5 0.8552
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10035859 30.0 0.7909

Lus10031756 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.