Lus10031759 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 107 / 2e-30 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 86 / 3e-22 EXLB2 Barwin-related endoglucanase (.1)
AT4G38210 45 / 7e-06 ATHEXPALPHA1.23, ATEXP20, ATEXPA20 EXPANSIN 20, expansin A20 (.1)
AT1G62980 45 / 7e-06 ATHEXPALPHA1.25, ATEXP18, ATEXPA18 EXPANSIN 18, expansin A18 (.1)
AT2G03090 40 / 0.0002 ATHEXPALPHA1.3, ATEXP15, ATEXPA15 EXPANSIN 15, expansin A15 (.1)
AT4G17030 39 / 0.0004 ATHEXPBETA3.1, ATEXPR1, AT-EXPR, ATEXLB1 expansin-like B1 (.1)
AT5G39260 39 / 0.0007 ATHEXPALPHA1.20, ATEXP21, ATEXPA21 EXPANSIN 21, expansin A21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031760 112 / 8e-33 AT4G30380 72 / 1e-17 Barwin-related endoglucanase (.1)
Lus10019978 99 / 6e-27 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10042435 79 / 6e-19 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026929 67 / 8e-15 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10026931 69 / 2e-14 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10026232 65 / 2e-13 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10030078 62 / 9e-13 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10042436 59 / 7e-12 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1)
Lus10026930 60 / 3e-11 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G179300 125 / 2e-37 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 123 / 8e-37 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.018G098200 99 / 5e-27 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G176300 96 / 3e-26 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.003G218300 92 / 2e-24 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G252200 65 / 4e-14 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G029100 65 / 5e-14 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G155000 50 / 4e-08 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.006G249500 47 / 5e-07 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901 45 / 1e-06 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10031759 pacid=23180782 polypeptide=Lus10031759 locus=Lus10031759.g ID=Lus10031759.BGIv1.0 annot-version=v1.0
ATGGAACACAAGCTAGCACTGATCGCAACAACAACAATGGTGGTTTTGGTCATGCTCTGCTCTCTTCCGAACCCTTCGGAAGCTGACCAAGGCCTCGCCG
TCTTCCACGACAAATACACACCTTCGGCCTGCTACGGGGGACAGAACAGGGGGGACATGATAACAGGGGTGAGCGACAAGCTGTGGAACAGAGGCGGAGC
TTGTGGGACGAGATACAGAGTTAGATGCATTGGGCGGGCGAATACAGCCCCCAACGCTTGCAAAACCACCACCGGAGCTGTTATAGTCACCGTCACCGAC
TACTGCAAAGAATGCACCGGCGACATCAACCTCTCCAGGGCTGCTTTCGCCAGGATTGCCAACATCGACGCCGGCAAAGTCCGGGTGGCATACGACCAGT
TTTCGAGATCGATCGACTTCGGAGTTGAGATGATGCTGATGGTGTACAAGAATAAGAGAGATTGGAGAAATAACTAG
AA sequence
>Lus10031759 pacid=23180782 polypeptide=Lus10031759 locus=Lus10031759.g ID=Lus10031759.BGIv1.0 annot-version=v1.0
MEHKLALIATTTMVVLVMLCSLPNPSEADQGLAVFHDKYTPSACYGGQNRGDMITGVSDKLWNRGGACGTRYRVRCIGRANTAPNACKTTTGAVIVTVTD
YCKECTGDINLSRAAFARIANIDAGKVRVAYDQFSRSIDFGVEMMLMVYKNKRDWRNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10031759 0 1
AT1G68460 ATIPT1 Arabidopsis thaliana isopenten... Lus10034334 6.9 0.6515
AT1G01490 Heavy metal transport/detoxifi... Lus10039285 16.3 0.6500
AT1G58210 EMB1674 EMBRYO DEFECTIVE 1674, kinase ... Lus10032844 22.1 0.6482
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Lus10024367 23.5 0.6057
AT5G09220 AAP2 amino acid permease 2 (.1) Lus10027109 25.5 0.5737
AT1G17800 AtENODL22 early nodulin-like protein 22 ... Lus10020984 26.6 0.6224
Lus10003448 31.0 0.6306
AT5G07990 CYP75B1, D501, ... TRANSPARENT TESTA 7, CYTOCHROM... Lus10013150 41.0 0.6348
AT2G25720 unknown protein Lus10042976 58.6 0.6217
AT3G07600 Heavy metal transport/detoxifi... Lus10016060 59.1 0.5956

Lus10031759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.