Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30380 62 / 8e-14 EXLB2 Barwin-related endoglucanase (.1) AT2G18660 54 / 1e-10 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031759 [exp] 91 / 1e-24 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1) Lus10019978 [exp] 49 / 1e-08 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1) Lus10042436 [exp] 45 / 2e-07 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1) Lus10026232 [exp] 39 / 8e-05 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1) Lus10042435 [exp] 37 / 0.0004 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G101600 [exp] 68 / 3e-16 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1) Potri.006G179300 [exp] 68 / 4e-16 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1) Potri.018G098200 [exp] 68 / 4e-16 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.006G176300 [exp] 65 / 4e-15 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1) Potri.006G252200 [exp] 38 / 0.0001 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1) Potri.018G029100 [exp] 36 / 0.0008 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF03330 [flax] [poplar] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Lus10031760 pacid=23180597 polypeptide=Lus10031760 locus=Lus10031760.g ID=Lus10031760.BGIv1.0 annot-version=v1.0 ATGATAGCGGGAGTGAGCGACAAGCTATGGGACGGAGGGAGGGCTTGTGGGAAGACATTCAAGGTGATATACAGAGGGCCGGCGAATACGTCGCCCAACG CTTGTAAAACCACCACCGGAGATGTTATCGTCACTATCACCGACTACTGTAAGGGTTGCAACGGCGACATCAACCTCTCCAGGTTTGCTTTCGACAAGAT CGCCTACGTCGACGCGGGCAAAGTTCAAGTTGACTACTATCAGTAA
AA sequence Show only first row Show all	>Lus10031760 pacid=23180597 polypeptide=Lus10031760 locus=Lus10031760.g ID=Lus10031760.BGIv1.0 annot-version=v1.0 MIAGVSDKLWDGGRACGKTFKVIYRGPANTSPNACKTTTGDVIVTITDYCKGCNGDINLSRFAFDKIAYVDAGKVQVDYYQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10031760 [exp]	0	1
AT5G51160			Ankyrin repeat family protein ...		Lus10029006 [exp]	4.8	0.8364
AT1G74090		SOT18, ATSOT18,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Lus10003069 [exp]	8.7	0.8170
AT5G23240			DNAJ heat shock N-terminal dom...		Lus10022246 [exp]	17.0	0.8109
AT5G42750		BKI1	BRI1 kinase inhibitor 1 (.1)		Lus10021736 [exp]	18.5	0.8254
AT5G23240			DNAJ heat shock N-terminal dom...		Lus10008768 [exp]	19.3	0.8007
AT5G01750			Protein of unknown function (D...		Lus10025254 [exp]	24.6	0.8106
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040735 [exp]	29.3	0.8122
AT2G45010			PLAC8 family protein (.1.2)		Lus10028184 [exp]	29.5	0.7950
AT2G39650			Protein of unknown function (D...		Lus10020938 [exp]	39.5	0.7668
AT3G50470		MLA10, HR3	INTRACELLULAR MILDEW A 10, hom...		Lus10000836 [exp]	45.4	0.6959

Compare expression of checked genes

Lus10031760 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.