Plant FIBer expression Database

Lus10031766 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12910 58 / 2e-10 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031189
[exp]
183 / 4e-57 AT3G12910 264 / 9e-87 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G098000
[exp]
71 / 8e-15 AT3G12910 271 / 2e-90 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.007G066300
[exp]
61 / 3e-11 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10031766 pacid=23180649 polypeptide=Lus10031766 locus=Lus10031766.g ID=Lus10031766.BGIv1.0 annot-version=v1.0
ATGTTACAAGAGGTATGGACGATATGTCGAATATTCAAAAGAAGTTCATCGAACAGAAAGTACACTCCAGACTGGAGAGAATTGTCCACCTCCAAACGGC
CCTTTACTAACCCTAATTCCAACAATTACTACAACAACAACAACACCTCAGGAGCTACAACAACTCATCAGCAACACTTCATCGACTTCACTGCCCCCCA
CGTCCAATCATTAGACACGAAACCCCCGATGAGCCAGCACCACGTGGTGGGGCCATCACGAGACGATGATCAGTCCATCATCATGTCCACGATGATGATG
ATGGACAGATCATCGTCTATTATAACACCATCCAGATCGACAACTGCATTACCTTCTACGAATTCTTCTCATCATTCGGAGTTGGTGGCTCCTCAGAGCA
GTTCTTCGATGGCTTCATCTACGTCGAACATTTCGAGCCCTTACGGGAATGATCAGTTCCTGACCTATGGAGACTTCGACGAGCTTAGATCTGTGGTTGA
GTTTGCCTTTGATCCTTCCAATAACTTTCTGTAA
AA sequence
>Lus10031766 pacid=23180649 polypeptide=Lus10031766 locus=Lus10031766.g ID=Lus10031766.BGIv1.0 annot-version=v1.0
MLQEVWTICRIFKRSSSNRKYTPDWRELSTSKRPFTNPNSNNYYNNNNTSGATTTHQQHFIDFTAPHVQSLDTKPPMSQHHVVGPSRDDDQSIIMSTMMM
MDRSSSIITPSRSTTALPSTNSSHHSELVAPQSSSSMASSTSNISSPYGNDQFLTYGDFDELRSVVEFAFDPSNNFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12910 NAC NAC (No Apical Meristem) domai... Lus10031766
[exp]
0 1
AT3G18570 Oleosin family protein (.1) Lus10017992
[exp]
2.4 0.8948
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10028502
[exp]
8.1 0.8762
AT2G43000 NAC ANAC042, JUB1, ... NAC domain containing protein ... Lus10031767
[exp]
8.5 0.8694
Lus10014377
[exp]
21.9 0.8307
Lus10001144
[exp]
21.9 0.8107
Lus10012066
[exp]
22.4 0.8479
AT1G33030 O-methyltransferase family pro... Lus10009442
[exp]
24.2 0.8592
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10028501
[exp]
25.7 0.8371
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10042493
[exp]
25.9 0.8515
AT3G18670 Ankyrin repeat family protein ... Lus10019888
[exp]
29.2 0.7863

Lus10031766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.