Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43000 228 / 4e-75 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT1G26870 218 / 3e-69 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G39820 214 / 4e-69 NAC ANAC094 NAC domain containing protein 94 (.1) AT3G12910 206 / 3e-66 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G02450 170 / 6e-51 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT1G69490 162 / 1e-49 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G61110 160 / 6e-48 NAC ANAC025 NAC domain containing protein 25 (.1) AT5G63790 159 / 7e-48 NAC ANAC102 NAC domain containing protein 102 (.1) AT3G04070 159 / 2e-47 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT3G15510 159 / 4e-47 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031189 [exp] 341 / 3e-118 AT3G12910 264 / 9e-87 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10030478 [exp] 224 / 1e-71 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10036749 [exp] 223 / 9e-71 AT1G26870 306 / 4e-100 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10037178 [exp] 222 / 2e-70 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1) Lus10015367 [exp] 218 / 3e-70 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10007263 [exp] 214 / 2e-68 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1) Lus10038332 [exp] 206 / 2e-66 AT2G43000 231 / 1e-75 NAC domain containing protein 42 (.1) Lus10036194 [exp] 201 / 1e-64 AT3G12910 224 / 1e-72 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10030446 [exp] 168 / 1e-51 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G066300 [exp] 250 / 1e-83 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G098000 [exp] 249 / 6e-83 AT3G12910 271 / 2e-90 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G057200 [exp] 229 / 4e-75 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1) Potri.005G205400 [exp] 227 / 2e-74 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1) Potri.001G080900 [exp] 223 / 6e-73 AT2G43000 257 / 3e-85 NAC domain containing protein 42 (.1) Potri.003G149700 [exp] 217 / 1e-70 AT2G43000 245 / 2e-80 NAC domain containing protein 42 (.1) Potri.004G126901 [exp] 214 / 4e-68 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1) Potri.017G082000 [exp] 213 / 9e-68 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G166500 [exp] 162 / 1e-49 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G046700 [exp] 166 / 2e-49 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10031767 pacid=23180770 polypeptide=Lus10031767 locus=Lus10031767.g ID=Lus10031767.BGIv1.0 annot-version=v1.0 ATGAACTCTAGTACTGTAACCTCTGATGATAACTGTGATCATGATCATCGGGATCGTGAGGAGGAGGAAGAGGAGGAAGAAGACGACGATGTTTCGCTAC CCGGGTTCCGATTCCATCCGACGGACGAAGAGCTTCTGAGCTTTTATCTACGGAGGAAAGTTGACAACAAGCCCCTCAGCATCGAGCTCATCAAGCAAGT TGATATCTACAAATATGATCCTTGGGATCTTCCAAGATCAACTGGGGATGGAGATAAAGAAGGCTACTTCTTCTGCAGAAGGGGGAGGAAGTACAGGAAC AGCATCAGGCCTAATCGGGTTACGGGTTCCGGGTTCTGGAAAGCAACCGGGATCGACAAACCGGTTTACTCCATGGCCGGAGACAACTGCATCGGCCTGA AGAAGACTCTAGTTTACTACAGGGGCAGCGCCGGAAAGGGAACCAAAACCGATTGGATGATGCACGAATTTCGCCTCCCGACCTCGGACCAAACCGGTAC CAACAACATCAATGGCTACATCACTAGCTCGGAATCCTCGAAGCTCACATCCGCCCAAGAAGCTTCTCATGTACCTTTGAAACAACTTGCTGGTCAAGAT GGTAAGGAACCGGTCAAATGGGCGGGTTGGGTAAGTTACGAGTTGGGTTAA
AA sequence Show only first row Show all	>Lus10031767 pacid=23180770 polypeptide=Lus10031767 locus=Lus10031767.g ID=Lus10031767.BGIv1.0 annot-version=v1.0 MNSSTVTSDDNCDHDHRDREEEEEEEEDDDVSLPGFRFHPTDEELLSFYLRRKVDNKPLSIELIKQVDIYKYDPWDLPRSTGDGDKEGYFFCRRGRKYRN SIRPNRVTGSGFWKATGIDKPVYSMAGDNCIGLKKTLVYYRGSAGKGTKTDWMMHEFRLPTSDQTGTNNINGYITSSESSKLTSAQEASHVPLKQLAGQD GKEPVKWAGWVSYELG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43000	NAC	ANAC042, JUB1, ...	NAC domain containing protein ...		Lus10031767 [exp]	0	1
AT5G18170		GDH1	glutamate dehydrogenase 1 (.1)		Lus10020288 [exp]	3.9	0.9228
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10031766 [exp]	8.5	0.8694
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Lus10016884 [exp]	10.1	0.9087
AT1G78100		AUF1	auxin up-regulated f-box prote...		Lus10041123 [exp]	11.1	0.8980
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10030901 [exp]	11.7	0.9133
AT5G04760	MYB		Duplicated homeodomain-like su...		Lus10036413 [exp]	20.4	0.8969
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Lus10037750 [exp]	23.6	0.8913
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10028502 [exp]	24.7	0.8730
AT1G33030			O-methyltransferase family pro...		Lus10009442 [exp]	25.6	0.8860
					Lus10012066 [exp]	27.5	0.8687

Compare expression of checked genes

Lus10031767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.