Lus10031777 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56140 187 / 3e-55 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56130 186 / 6e-55 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56120 182 / 2e-53 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56145 170 / 3e-49 Leucine-rich repeat transmembrane protein kinase (.1.2)
AT1G07650 128 / 2e-34 Leucine-rich repeat transmembrane protein kinase (.1.2)
AT1G53430 127 / 5e-34 Leucine-rich repeat transmembrane protein kinase (.1.2)
AT1G16670 123 / 7e-34 Protein kinase superfamily protein (.1)
AT1G53440 123 / 9e-33 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G29730 122 / 1e-32 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G29720 118 / 5e-31 Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031199 248 / 4e-77 AT1G56130 1261 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Lus10026207 125 / 1e-34 AT1G16670 541 / 0.0 Protein kinase superfamily protein (.1)
Lus10031374 127 / 3e-34 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2)
Lus10042460 124 / 5e-34 AT1G16670 536 / 0.0 Protein kinase superfamily protein (.1)
Lus10041937 116 / 3e-30 AT1G53440 1138 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Lus10005550 115 / 8e-30 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Lus10028149 110 / 6e-29 AT1G16670 434 / 6e-152 Protein kinase superfamily protein (.1)
Lus10042851 110 / 6e-29 AT1G16670 429 / 3e-149 Protein kinase superfamily protein (.1)
Lus10031401 111 / 8e-29 AT1G56140 337 / 4e-105 Leucine-rich repeat transmembrane protein kinase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G067900 211 / 2e-63 AT1G56130 1290 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Potri.001G082900 185 / 2e-54 AT1G56140 1097 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Potri.003G148000 177 / 1e-51 AT1G56145 1063 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2)
Potri.001G385300 132 / 7e-36 AT1G53440 1134 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Potri.001G386300 132 / 7e-36 AT1G53440 1120 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Potri.011G073191 125 / 2e-35 AT1G07650 370 / 1e-120 Leucine-rich repeat transmembrane protein kinase (.1.2)
Potri.011G073066 127 / 3e-35 AT1G07650 488 / 1e-164 Leucine-rich repeat transmembrane protein kinase (.1.2)
Potri.011G073316 127 / 4e-35 AT1G07650 487 / 4e-164 Leucine-rich repeat transmembrane protein kinase (.1.2)
Potri.011G072841 126 / 7e-35 AT1G07650 489 / 3e-165 Leucine-rich repeat transmembrane protein kinase (.1.2)
Potri.004G135500 129 / 9e-35 AT1G07650 1324 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2)
PFAM info
Representative CDS sequence
>Lus10031777 pacid=23180713 polypeptide=Lus10031777 locus=Lus10031777.g ID=Lus10031777.BGIv1.0 annot-version=v1.0
ATGGGAAATTCGTTACCTGCTGCGATTGCTTTGATTCTCGTCCTCGCTGCTTCTTCTTCAATCGGTGGTGTTTTCCGAGTTGCTCGAGCTCAGAATCAAA
CTCGTCGAGATACCACTGATCCTGATGAAGATTGCGGGCTGGCGAAACTCTACGATGATAAGAAGACTCACATCAGCACCCGTGTTGCAGGAACAATCCA
CCTTACGGAGAAAGCTGACGTCTTCGCCTTCGGAGTCGTAGCTCTAGAAATCGTGAGCGGGAGGCCAAATTCAGACACGACACTGTACGAGGAAAGAATG
TACCCTCTCGAATGGGCGTGGTTCTTACACGAGAACAACCGGGAAGTGGAGCTGGCGGACTCCAGATTGTCCTCGGAATTCGACGAAGACGAGCTCAAAC
GATTCGTCGGAATCGCCCTCCTCTGTGCTTCCCCTAGTTTGCGGCCCTCGATGTCCCGAGTCGTGGCCATGCTATCCGGAGACGTTGAAGTGGGAGCTGT
ATCGTCGAGGCCTGGCTATTTGACTGACTTGGAAGTATGA
AA sequence
>Lus10031777 pacid=23180713 polypeptide=Lus10031777 locus=Lus10031777.g ID=Lus10031777.BGIv1.0 annot-version=v1.0
MGNSLPAAIALILVLAASSSIGGVFRVARAQNQTRRDTTDPDEDCGLAKLYDDKKTHISTRVAGTIHLTEKADVFAFGVVALEIVSGRPNSDTTLYEERM
YPLEWAWFLHENNREVELADSRLSSEFDEDELKRFVGIALLCASPSLRPSMSRVVAMLSGDVEVGAVSSRPGYLTDLEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56140 Leucine-rich repeat transmembr... Lus10031777 0 1
Lus10001533 1.7 0.9624
AT3G49210 O-acyltransferase (WSD1-like) ... Lus10033680 2.0 0.9589
AT5G65165 SDH2-3 succinate dehydrogenase 2-3 (.... Lus10028289 3.5 0.9429
AT1G05160 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, ... Lus10036671 3.7 0.8984
AT5G01930 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl ... Lus10022729 4.2 0.9503
AT4G34150 Calcium-dependent lipid-bindin... Lus10002825 4.9 0.8837
AT5G46090 Protein of unknown function (D... Lus10013933 5.9 0.9218
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10021233 6.5 0.9221
AT4G34410 AP2_ERF RRTF1 (Redox Re... redox responsive transcription... Lus10014054 8.7 0.9248
AT4G23310 CRK23 cysteine-rich RLK (RECEPTOR-li... Lus10023335 9.4 0.9193

Lus10031777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.