Lus10031781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55710 212 / 6e-70 AtTic20-V translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
AT2G47840 118 / 3e-33 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031203 293 / 3e-102 AT5G55710 263 / 3e-90 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Lus10020219 102 / 7e-27 AT2G47840 222 / 1e-73 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Lus10026842 100 / 8e-26 AT2G47840 219 / 1e-72 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G191700 237 / 5e-80 AT5G55710 228 / 2e-76 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Potri.013G084900 102 / 3e-27 AT2G47840 196 / 2e-63 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
PFAM info
Representative CDS sequence
>Lus10031781 pacid=23180812 polypeptide=Lus10031781 locus=Lus10031781.g ID=Lus10031781.BGIv1.0 annot-version=v1.0
ATGTCTGCTCTCCTCCGCATATCTCCGCCGCTTACTCTCTCAGCCAAACATCACCTACCAAGCTCCCGAATCCTGAAGCCATCCTCCTCCTCCTCCACGC
GGTTAACAGTAACCGCCAAATCCAACGGCAGCAGCAACTCCGTCGACGCAGGGGACCGGATAATCTCCGCGGTCACCTACTTCTACCCGTTCTTCGACGG
TGTACAGTACGGGAAGTACGTAATCATCCAGTTCGCTCCAATCCAGACGCTAATCCAGCCGCTTTTCCCCGCGATTAAGGTCTACAAAAGCTTCCCGCTC
AACGGCGTCCTGGTGTTCATGGCCCTCTACTTCGCGGTGGTGAGGAACTCCAACTTCAGTAGGTACGTGCGGTTCAACACGATGCAGGCGATCGTGCTGG
ACGTGCTCCTGATTTTCCCTGATTTGCTCGAGAGGAGCTTCAATCCGAAAGAAGGCGTTGGGTTGGATCTTGTGATGAGCCTCGATAGCACTGTTTTCTT
GTTCCTTTTGGTTAGCTTGGTTTATGGATCCAGTTCTTGCTTGCTCGGCCAGCTCCCTCGATTGCCCATTGTTGCTGATGCCGCTGACAGGCAAGTTCTG
TGA
AA sequence
>Lus10031781 pacid=23180812 polypeptide=Lus10031781 locus=Lus10031781.g ID=Lus10031781.BGIv1.0 annot-version=v1.0
MSALLRISPPLTLSAKHHLPSSRILKPSSSSSTRLTVTAKSNGSSNSVDAGDRIISAVTYFYPFFDGVQYGKYVIIQFAPIQTLIQPLFPAIKVYKSFPL
NGVLVFMALYFAVVRNSNFSRYVRFNTMQAIVLDVLLIFPDLLERSFNPKEGVGLDLVMSLDSTVFLFLLVSLVYGSSSCLLGQLPRLPIVADAADRQVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55710 AtTic20-V translocon at the inner envelo... Lus10031781 0 1
AT5G55710 AtTic20-V translocon at the inner envelo... Lus10031203 1.0 0.8803
AT1G15100 RHA2A RING-H2 finger A2A (.1) Lus10007937 2.6 0.8125
AT2G31040 ATP synthase protein I -relate... Lus10029836 5.7 0.8523
AT5G48500 unknown protein Lus10009584 6.7 0.8399
AT3G10960 ATAZG1 AZA-guanine resistant1 (.1) Lus10009102 8.9 0.8087
AT2G29630 PY, THIC PYRIMIDINE REQUIRING, thiaminC... Lus10018211 12.5 0.8252
AT5G60750 CAAX amino terminal protease f... Lus10028751 18.0 0.7697
AT3G49220 Plant invertase/pectin methyle... Lus10018103 20.8 0.7690
AT2G01590 CRR3 chlororespiratory reduction 3 ... Lus10027792 26.1 0.8170
AT3G27390 unknown protein Lus10032110 27.4 0.8139

Lus10031781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.