Lus10031782 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031204 46 / 4e-07 AT2G32210 47 / 4e-08 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10031782 pacid=23180643 polypeptide=Lus10031782 locus=Lus10031782.g ID=Lus10031782.BGIv1.0 annot-version=v1.0
ATGGAAGCCGGAATTTCGAAAAGCTTCATTCACACCATCCGTGGCTGGCTGGCAGCTGAATGCCGATTCCACTCTTTGTCTGTCTTGGATGCATATCCAC
CACCGGGGCAAGCATATCCACCACCGGGGCAAGCATATCCACCACCGGGTCAGGCGTACCCACCTCCTCAAGGTTCGGAATACCCGCCGCCACCGCCGCC
ACAGTATCAACCATACCCGCCGCCACAACAGGCAGCATACTACCCTCATAATCCACATGCTGCTGCTGCTCCACCTCCAGCCGGCTACCCACCGGTTCCG
GCAGATCATGGACATCAGCAGCCGCCTGCTGCCAACACTCAAAGTAAAGGCGATGGCTTTTTGAAAGGATGGTAA
AA sequence
>Lus10031782 pacid=23180643 polypeptide=Lus10031782 locus=Lus10031782.g ID=Lus10031782.BGIv1.0 annot-version=v1.0
MEAGISKSFIHTIRGWLAAECRFHSLSVLDAYPPPGQAYPPPGQAYPPPGQAYPPPQGSEYPPPPPPQYQPYPPPQQAAYYPHNPHAAAAPPPAGYPPVP
ADHGHQQPPAANTQSKGDGFLKGW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32190 unknown protein Lus10031782 0 1
AT3G54340 MADS AP3, ATAP3 APETALA 3, K-box region and MA... Lus10041807 2.8 0.8038
AT5G19260 FAF3 FANTASTIC FOUR 3, Protein of u... Lus10010520 4.9 0.8490
AT2G39830 LRD3, DAR2 LATERAL ROOT DEVELOPMENT 3, DA... Lus10004690 5.1 0.8537
AT5G37730 unknown protein Lus10017628 10.5 0.7521
AT4G25350 SHB1 SHORT HYPOCOTYL UNDER BLUE1, E... Lus10037146 14.5 0.7600
AT1G05610 APS2 ADP-glucose pyrophosphorylase ... Lus10026213 18.3 0.8161
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10034567 18.8 0.7952
AT1G70280 NHL domain-containing protein ... Lus10032158 19.1 0.7939
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Lus10036966 20.1 0.7408
AT4G22990 Major Facilitator Superfamily ... Lus10009314 29.3 0.7567

Lus10031782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.