Lus10031790 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12955 73 / 4e-17 SAUR-like auxin-responsive protein family (.1)
AT5G20820 71 / 1e-16 SAUR-like auxin-responsive protein family (.1)
AT1G17345 63 / 2e-13 SAUR-like auxin-responsive protein family (.1)
AT1G72430 57 / 2e-11 SAUR-like auxin-responsive protein family (.1)
AT4G34750 38 / 0.0005 SAUR-like auxin-responsive protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037443 61 / 3e-12 AT1G72430 114 / 1e-33 SAUR-like auxin-responsive protein family (.1)
Lus10013181 57 / 5e-11 AT1G72430 119 / 9e-36 SAUR-like auxin-responsive protein family (.1)
Lus10034507 42 / 4e-05 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10033161 38 / 0.0008 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G143400 104 / 1e-29 AT3G12955 91 / 2e-24 SAUR-like auxin-responsive protein family (.1)
Potri.001G458000 99 / 2e-27 AT3G12955 86 / 3e-22 SAUR-like auxin-responsive protein family (.1)
Potri.003G071000 67 / 7e-15 AT1G72430 126 / 9e-39 SAUR-like auxin-responsive protein family (.1)
Potri.006G137000 66 / 9e-15 AT5G20820 135 / 3e-42 SAUR-like auxin-responsive protein family (.1)
Potri.001G164300 51 / 8e-09 AT1G72430 108 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 42 / 4e-05 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.006G070600 41 / 4e-05 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10031790 pacid=23180750 polypeptide=Lus10031790 locus=Lus10031790.g ID=Lus10031790.BGIv1.0 annot-version=v1.0
ATGAAGAAGATCAACTTGCTACTCAGAAAGTGTAAGAGCCTCTCCAAGCAGCTCGGAAGATCTTCATCCTACAGCAGCTTAAGATCATCCAAGAATGATC
ACCACCACCACCAGCAGCTATGGAGGTCTCAAAGTAACATTTATCATCATCATCACCATCATCAAGATGGCGGTGATGATGATGATGATCGGCAGACGGT
GTTTGTCGGGAGCACGAGGAAGAGGTACGTGATTAGCTCCAAGTGCTTGAGCCACCCCGTCGTGAATGCTCTGATCACTCATGACGACGGTGGTAATGGT
GGGACGGCTGTGGTGAAATGTGAGGTGGTTCTCTTTGACCACTTATTGTGGATGCTAGACAATGCTGAGATCACCGACGGTGATCTCAGCATCGAGTCCC
TGCAGGAACTTGCGGATCTCTACGTGTTTTGA
AA sequence
>Lus10031790 pacid=23180750 polypeptide=Lus10031790 locus=Lus10031790.g ID=Lus10031790.BGIv1.0 annot-version=v1.0
MKKINLLLRKCKSLSKQLGRSSSYSSLRSSKNDHHHHQQLWRSQSNIYHHHHHHQDGGDDDDDRQTVFVGSTRKRYVISSKCLSHPVVNALITHDDGGNG
GTAVVKCEVVLFDHLLWMLDNAEITDGDLSIESLQELADLYVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12955 SAUR-like auxin-responsive pro... Lus10031790 0 1
AT1G23390 Kelch repeat-containing F-box ... Lus10013033 3.5 0.9525
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008938 4.7 0.9590
AT3G59530 LAP3 LESS ADHERENT POLLEN 3, Calciu... Lus10019377 7.1 0.9418
AT1G05310 Pectin lyase-like superfamily ... Lus10010470 9.8 0.9462
AT5G03810 GDSL-like Lipase/Acylhydrolase... Lus10008635 10.4 0.9427
AT5G15870 glycosyl hydrolase family 81 p... Lus10042526 13.1 0.9369
AT3G59310 Eukaryotic protein of unknown ... Lus10026744 16.9 0.9362
AT5G15870 glycosyl hydrolase family 81 p... Lus10042525 17.0 0.9217
AT1G70420 Protein of unknown function (D... Lus10002380 18.2 0.9398
AT4G12350 MYB ATMYB42 myb domain protein 42 (.1) Lus10024589 18.3 0.9377

Lus10031790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.