Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30130 220 / 4e-74 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G16530 168 / 9e-54 AS2 ASL9, LBD3 LOB DOMAIN-CONTAINING PROTEIN 3, ASYMMETRIC LEAVES 2-like 9 (.1) AT1G31320 162 / 2e-51 AS2 LBD4 LOB domain-containing protein 4 (.1) AT1G07900 158 / 1e-49 AS2 LBD1 LOB domain-containing protein 1 (.1) AT2G28500 158 / 5e-49 AS2 LBD11 LOB domain-containing protein 11 (.1) AT5G63090 151 / 5e-47 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT2G30340 150 / 1e-45 AS2 LBD13 LOB domain-containing protein 13 (.1) AT3G27650 145 / 6e-45 AS2 LBD25 LOB domain-containing protein 25 (.1) AT3G26620 142 / 5e-44 AS2 LBD23 LOB domain-containing protein 23 (.1) AT3G26660 142 / 5e-44 AS2 LBD24 LOB domain-containing protein 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031285 [exp] 330 / 1e-117 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10007525 [exp] 208 / 3e-69 AT2G30130 204 / 1e-67 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10017431 [exp] 201 / 9e-67 AT2G30130 199 / 1e-65 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10040638 [exp] 182 / 2e-59 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10018275 [exp] 182 / 4e-59 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10031191 [exp] 177 / 2e-57 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1) Lus10031769 [exp] 176 / 3e-57 AT1G31320 193 / 8e-64 LOB domain-containing protein 4 (.1) Lus10040373 [exp] 159 / 3e-49 AT2G28500 211 / 7e-69 LOB domain-containing protein 11 (.1) Lus10036130 [exp] 156 / 4e-48 AT2G28500 207 / 1e-67 LOB domain-containing protein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G281600 [exp] 249 / 8e-86 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.009G076900 [exp] 241 / 1e-82 AT2G30130 228 / 2e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.010G184400 [exp] 237 / 3e-81 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.008G072800 [exp] 237 / 4e-81 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.005G097800 [exp] 183 / 3e-60 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.007G066700 [exp] 182 / 6e-60 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.001G081400 [exp] 182 / 2e-59 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 182 / 2e-59 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.008G043900 [exp] 162 / 9e-51 AT1G07900 218 / 2e-72 LOB domain-containing protein 1 (.1) Potri.010G217700 [exp] 161 / 2e-50 AT1G07900 203 / 1e-66 LOB domain-containing protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10031855 pacid=23180673 polypeptide=Lus10031855 locus=Lus10031855.g ID=Lus10031855.BGIv1.0 annot-version=v1.0 ATGGGAGGCACTTCACCTTGCGCATCTTGCAAGCTCCTAAGGCGCCGCTGCGCCAAAGACTGCATCTTCGCCCCTTACTTCCCCTCCGACGACCCCCACA AGTTCGCCATCGTCCACAAGGTCTTCGGCGCCAGCAACGTCAGCAAGATGCTGCAGGAGATTCCGGTGCAACATAGGGCAGACGCGGTGAGCAGCCTGGT GTACGAGGCGAACGCGAGAGTTCGAGACCCGGTGTACGGATGCGTGGGGGCGATATCGTTCCTCCAGAACCAAGTGTCCCAGCTTCAAATGCAGCTGGCC GTGGCACAAGCCGAGGTACTTTGCATCCAGATGCAGCAGCAGGACCCGGTATCATCGGCATCGGCATCAATCTTCCCAAACCCTACTGATCTACTAGATC ATAGCCAGCATCTCTTGGCAAGCTACGGCCTTAACTTCTCTTCTTCAGGTGCTACCAATACTGTAATCCAAGACCCTCTCAAGCGAGAGTCCCTTTGGAC TTAG
AA sequence Show only first row Show all	>Lus10031855 pacid=23180673 polypeptide=Lus10031855 locus=Lus10031855.g ID=Lus10031855.BGIv1.0 annot-version=v1.0 MGGTSPCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQEIPVQHRADAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLA VAQAEVLCIQMQQQDPVSSASASIFPNPTDLLDHSQHLLASYGLNFSSSGATNTVIQDPLKRESLWT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10031855 [exp]	0	1
					Lus10005247 [exp]	2.2	0.9407
AT3G14520		AtTPS18	Terpenoid cyclases/Protein pre...		Lus10002660 [exp]	6.0	0.9250
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10041707 [exp]	6.7	0.9507
AT3G19430			late embryogenesis abundant pr...		Lus10021837 [exp]	9.6	0.9444
AT5G54370			Late embryogenesis abundant (L...		Lus10031297 [exp]	10.0	0.9456
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10015634 [exp]	11.0	0.9319
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011746 [exp]	11.9	0.9454
AT5G65030			unknown protein		Lus10041694 [exp]	17.5	0.9131
AT5G65030			unknown protein		Lus10041693 [exp]	17.7	0.9128
AT3G14470			NB-ARC domain-containing disea...		Lus10002609 [exp]	19.7	0.9390

Compare expression of checked genes

Lus10031855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.