Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58660 118 / 1e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G47190 104 / 2e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G21200 89 / 1e-21 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) AT1G50960 71 / 3e-15 ATGA2OX7 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 7, gibberellin 2-oxidase 7 (.1) AT1G03410 68 / 6e-14 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 67 / 1e-13 ATJRG21 jasmonate-regulated gene 21 (.1) AT4G10490 66 / 2e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 66 / 3e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25310 64 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 64 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031294 [exp] 244 / 7e-76 AT5G58520 801 / 0.0 Protein kinase superfamily protein (.1) Lus10006759 [exp] 93 / 3e-23 AT4G21200 419 / 2e-147 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10030567 [exp] 92 / 9e-23 AT4G21200 370 / 2e-128 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10012912 [exp] 91 / 3e-22 AT4G21200 368 / 2e-127 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10029081 [exp] 90 / 4e-22 AT4G21200 365 / 3e-126 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10018372 [exp] 88 / 3e-21 AT4G21200 419 / 2e-147 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10007640 [exp] 86 / 2e-20 AT4G21200 429 / 1e-151 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10013069 [exp] 84 / 1e-19 AT4G21200 366 / 5e-126 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10027807 [exp] 72 / 9e-16 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G278200 [exp] 137 / 5e-40 AT5G58660 312 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G026700 [exp] 95 / 5e-24 AT4G21200 444 / 1e-157 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.004G022800 [exp] 95 / 6e-24 AT4G21200 441 / 7e-156 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.001G418200 [exp] 94 / 1e-23 AT4G21200 369 / 8e-128 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.008G145300 [exp] 87 / 6e-21 AT4G21200 354 / 1e-121 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.010G096800 [exp] 84 / 8e-20 AT4G21200 362 / 8e-125 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.011G134100 [exp] 82 / 4e-19 AT4G21200 324 / 2e-110 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.011G134000 [exp] 76 / 9e-17 AT4G21200 340 / 1e-116 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.010G188000 [exp] 70 / 7e-15 AT5G05600 511 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101100 [exp] 70 / 8e-15 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10031865 pacid=23180765 polypeptide=Lus10031865 locus=Lus10031865.g ID=Lus10031865.BGIv1.0 annot-version=v1.0 ATGGGAGAGCTGCTGGGAGTGGATCAATGCGGTGCTTACGTGTCAGAATCCACCGGCATCATCCGCGTTTACCGCTACCCTCAGAGTCCAGCTCAGCATG ATCAGACGGCGCCGCCGCCGTTGGGAATGCATGCCCATACCGACAGCTCGTTGGTGTCGATAGTGTTGGAAGACGACAAAGTGAGTGGGCTCCAGTTCAT CAAGGACGGCGGCGGCGATGGTAATGGGCTGACTCTTCAGCCCGTCCCCGACACCCTATTGATCAACATCGGAGACATGATTCAGGCTATAAGTAATGAT GAGTTTACGAGTGTGAAGCACAGAACAATCGAGACCTCCAAATACAAGCCTTTTACCTATGAGGAATACCACCAACAAGTACTAAAGGACACTAAAAATC TCGGGTTTAAAGTCGGACTCAAAAGGTTCAAACGAACTACTTAA
AA sequence Show only first row Show all	>Lus10031865 pacid=23180765 polypeptide=Lus10031865 locus=Lus10031865.g ID=Lus10031865.BGIv1.0 annot-version=v1.0 MGELLGVDQCGAYVSESTGIIRVYRYPQSPAQHDQTAPPPLGMHAHTDSSLVSIVLEDDKVSGLQFIKDGGGDGNGLTLQPVPDTLLINIGDMIQAISND EFTSVKHRTIETSKYKPFTYEEYHQQVLKDTKNLGFKVGLKRFKRTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58660			2-oxoglutarate (2OG) and Fe(II...		Lus10031865 [exp]	0	1
					Lus10000351 [exp]	3.3	1.0000
					Lus10002886 [exp]	4.7	1.0000
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	5.7	1.0000
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10023249 [exp]	6.6	1.0000
AT2G02850		ARPN	plantacyanin (.1)		Lus10028396 [exp]	7.4	1.0000
AT2G46530	ARF	ARF11	auxin response factor 11 (.1.2...		Lus10030240 [exp]	9.5	1.0000
					Lus10014748 [exp]	10.2	1.0000
AT1G69630			F-box/RNI-like superfamily pro...		Lus10031499 [exp]	10.5	0.8356
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10023106 [exp]	10.7	0.8839
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	11.0	1.0000

Compare expression of checked genes

Lus10031865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.